Recombinant Full Length Human CIDEC Protein, GST-tagged
Cat.No. : | CIDEC-1850HF |
Product Overview : | Human CIDEC full-length ORF ( AAH16851, 1 a.a. - 238 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 238 amino acids |
Description : | This gene encodes a member of the cell death-inducing DNA fragmentation factor-like effector family. Members of this family play important roles in apoptosis. The encoded protein promotes lipid droplet formation in adipocytes and may mediate adipocyte apoptosis. This gene is regulated by insulin and its expression is positively correlated with insulin sensitivity. Mutations in this gene may contribute to insulin resistant diabetes. A pseudogene of this gene is located on the short arm of chromosome 3. Alternatively spliced transcript variants that encode different isoforms have been observed for this gene. [provided by RefSeq, Dec 2010] |
Molecular Mass : | 51.92 kDa |
AA Sequence : | MEYAMKSLSLLYPKSLSRHVSVRTSVVTQQLLSEPSPKAPRARPCRVSTADRSVRKGIMAYSLEDLLLKVRDTLMLADKPFFLVLEEDGTTVETEEYFQALAGDTVFMVLQKGQKWQPPSEQGTRHPLSLSHKPAKKIDVARVTFDLYKLNPQDFIGRLNVKATFYDTYSLSYDLHCCGAKRIMKEAFRWALFSMQATGHVLLGTSCYLQQLLDATEEGQPPKGKASSLIPTCLKILQ |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CIDEC cell death-inducing DFFA-like effector c [ Homo sapiens ] |
Official Symbol | CIDEC |
Synonyms | CIDEC; cell death-inducing DFFA-like effector c; cell death activator CIDE-3; CIDE 3; FLJ20871; Fsp27; fat specific protein 27; CIDE3; FSP27; CIDE-3 |
Gene ID | 63924 |
mRNA Refseq | NM_001199551 |
Protein Refseq | NP_001186480 |
MIM | 612120 |
UniProt ID | Q96AQ7 |
◆ Recombinant Proteins | ||
CIDEC-413H | Recombinant Human CIDEC Protein, GST-His-tagged | +Inquiry |
CIDEC-5055C | Recombinant Chicken CIDEC | +Inquiry |
CIDEC-1365H | Recombinant Human CIDEC Protein, GST-tagged | +Inquiry |
CIDEC-1447H | Recombinant Human CIDEC protein, His & T7-tagged | +Inquiry |
CIDEC-1414R | Recombinant Rat CIDEC Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CIDEC-7495HCL | Recombinant Human CIDEC 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CIDEC Products
Required fields are marked with *
My Review for All CIDEC Products
Required fields are marked with *