Recombinant Full Length Human CKAP2 Protein, GST-tagged

• Cat.No.: CKAP2-1860HF
• Product Overview: Human CKAP2 full-length ORF ( AAH10901.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 161 amino acids
• Description: This gene encodes a cytoskeleton-associated protein that stabalizes microtubules and plays a role in the regulation of cell division. The encoded protein is itself regulated through phosphorylation at multiple serine and threonine residues. There is a pseudogene of this gene on chromosome 14. Alternative splicing results in multiple transcript variations. [provided by RefSeq, Nov 2013]
• Molecular Mass: 43.45 kDa
• AA Sequence: MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CKAP2 cytoskeleton associated protein 2 [ Homo sapiens ]
• Official Symbol: CKAP2
• Synonyms: CKAP2; cytoskeleton associated protein 2; cytoskeleton-associated protein 2; FLJ10749; LB1; se20 10; TMAP; CTCL tumor antigen se20-10; tumor- and microtubule-associated protein; tumor-associated microtubule-associated protein; se20-10; DKFZp686L1238
• Gene ID: 26586
• mRNA Refseq: NM_001098525
• Protein Refseq: NP_001091995
• MIM: 611569
• UniProt ID: Q8WWK9