Recombinant Human CKAP2 Protein, GST-tagged

Cat.No. : CKAP2-1390H
Product Overview : Human CKAP2 full-length ORF ( AAH10901.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene encodes a cytoskeleton-associated protein that stabalizes microtubules and plays a role in the regulation of cell division. The encoded protein is itself regulated through phosphorylation at multiple serine and threonine residues. There is a pseudogene of this gene on chromosome 14. Alternative splicing results in multiple transcript variations. [provided by RefSeq, Nov 2013]
Molecular Mass : 43.45 kDa
AA Sequence : MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CKAP2 cytoskeleton associated protein 2 [ Homo sapiens ]
Official Symbol CKAP2
Synonyms CKAP2; cytoskeleton associated protein 2; cytoskeleton-associated protein 2; FLJ10749; LB1; se20 10; TMAP; CTCL tumor antigen se20-10; tumor- and microtubule-associated protein; tumor-associated microtubule-associated protein; se20-10; DKFZp686L1238;
Gene ID 26586
mRNA Refseq NM_001098525
Protein Refseq NP_001091995
MIM 611569
UniProt ID Q8WWK9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CKAP2 Products

Required fields are marked with *

My Review for All CKAP2 Products

Required fields are marked with *

0
cart-icon
0
compare icon