Recombinant Human CKAP2 Protein, GST-tagged
Cat.No. : | CKAP2-1390H |
Product Overview : | Human CKAP2 full-length ORF ( AAH10901.1, 1 a.a. - 161 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a cytoskeleton-associated protein that stabalizes microtubules and plays a role in the regulation of cell division. The encoded protein is itself regulated through phosphorylation at multiple serine and threonine residues. There is a pseudogene of this gene on chromosome 14. Alternative splicing results in multiple transcript variations. [provided by RefSeq, Nov 2013] |
Molecular Mass : | 43.45 kDa |
AA Sequence : | MEKSEPVDQRRHTAGKAIVDSRSAQPKETSEERKARLSEWKAGKGRVLKRPPNSVVTQHEPAGQNEKPVGSFWTTMAEEDEQRLFTEKVNNTFSECLNLINEGCPKEDILVTLNDLIKNIPDAKKLVKYWICLALIEPITSPIENIIAIYEKAILAGAQVR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CKAP2 cytoskeleton associated protein 2 [ Homo sapiens ] |
Official Symbol | CKAP2 |
Synonyms | CKAP2; cytoskeleton associated protein 2; cytoskeleton-associated protein 2; FLJ10749; LB1; se20 10; TMAP; CTCL tumor antigen se20-10; tumor- and microtubule-associated protein; tumor-associated microtubule-associated protein; se20-10; DKFZp686L1238; |
Gene ID | 26586 |
mRNA Refseq | NM_001098525 |
Protein Refseq | NP_001091995 |
MIM | 611569 |
UniProt ID | Q8WWK9 |
◆ Recombinant Proteins | ||
Ckap2-614M | Recombinant Mouse Ckap2 Protein, His/GST-tagged | +Inquiry |
CKAP2-1860HF | Recombinant Full Length Human CKAP2 Protein, GST-tagged | +Inquiry |
CKAP2-1390H | Recombinant Human CKAP2 Protein, GST-tagged | +Inquiry |
CKAP2-1703M | Recombinant Mouse CKAP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
CKAP2-3490M | Recombinant Mouse CKAP2 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CKAP2-7486HCL | Recombinant Human CKAP2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CKAP2 Products
Required fields are marked with *
My Review for All CKAP2 Products
Required fields are marked with *