Recombinant Full Length Human claudin 2 Protein, Flag tagged

• Cat.No.: CLDN2-06HFL
• Product Overview: Recombinant protein of human claudin 2 (CLDN2) protein (1-230aa) with C-Flag tag was expressed in HEK293T.

Specification

• Species: Human
• Source: HEK293
• Tag: Flag
• Protein Length: 1-230aa
• Description: This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'' untranslated region have been found for this gene.
• Tag: C-Flag
• Molecular Mass: 24.4 kDa
• AA Sequence: MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Notes: For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process.
• Stability: Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
• Storage: Store at -80 centigrade.
• Storage Buffer: 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol
• Concentration: > 0.05 μg/μL as determined by microplate BCA method

Gene Information

• Gene Name: CLDN2 claudin 2 [ Homo sapiens (human) ]
• Official Symbol: CLDN2
• Synonyms: CLDN2; claudin 2; claudin-2; SP82; OAZON
• Gene ID: 9075
• mRNA Refseq: NM_020384
• Protein Refseq: NP_065117
• MIM: 300520
• UniProt ID: P57739