Recombinant Full Length Human claudin 2 Protein, Flag tagged
Cat.No. : | CLDN2-06HFL |
Product Overview : | Recombinant protein of human claudin 2 (CLDN2) protein (1-230aa) with C-Flag tag was expressed in HEK293T. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | HEK293 |
Tag : | Flag |
Protein Length : | 1-230aa |
Description : | This gene product belongs to the claudin protein family whose members have been identified as major integral membrane proteins localized exclusively at tight junctions. Claudins are expressed in an organ-specific manner and regulate tissue-specific physiologic properties of tight junctions. This protein is expressed in the intestine. Alternatively spliced transcript variants with different 5'' untranslated region have been found for this gene. |
Tag : | C-Flag |
Molecular Mass : | 24.4 kDa |
AA Sequence : | MASLGLQLVGYILGLLGLLGTLVAMLLPSWKTSSYVGASIVTAVGFSKGLWMECATHSTGITQCDIYSTLLGLPADIQAAQAMMVTSSAISSLACIISVVGMRCTVFCQESRAKDRVAVAGGVFFILGGLLGFIPVAWNLHGILRDFYSPLVPDSMKFEIGEALYLGIISSLFSLIAGIILCFSCSSQRNRSNYYDAYQAQPLATRSSPRPGQPPKVKSEFNSYSLTGYVTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining |
Notes : | For testing in cell culture applications, please filter before use. Note that you may experience some loss of protein during the filtration process. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Storage Buffer : | 25 mM Tris-HCl, 100 mM glycine, pH 7.3, 10% glycerol |
Concentration : | > 0.05 μg/μL as determined by microplate BCA method |
Gene Name | CLDN2 claudin 2 [ Homo sapiens (human) ] |
Official Symbol | CLDN2 |
Synonyms | CLDN2; claudin 2; claudin-2; SP82; OAZON |
Gene ID | 9075 |
mRNA Refseq | NM_020384 |
Protein Refseq | NP_065117 |
MIM | 300520 |
UniProt ID | P57739 |
◆ Recombinant Proteins | ||
Cldn2-900M | Recombinant Mouse Cldn2 Protein, MYC/DDK-tagged | +Inquiry |
CLDN2-1438H | Recombinant Human CLDN2 Protein, GST-tagged | +Inquiry |
CLDN2-1282Z | Recombinant Zebrafish CLDN2 | +Inquiry |
CLDN2-0405H | Recombinant Human CLDN2 Protein (Met1-Val230), C-His-tagged | +Inquiry |
CLDN2-1091H | Recombinant Human CLDN2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN2-7466HCL | Recombinant Human CLDN2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN2 Products
Required fields are marked with *
My Review for All CLDN2 Products
Required fields are marked with *
0
Inquiry Basket