Recombinant Full Length Human Claudin-5(Cldn5) Protein, His-Tagged
Cat.No. : | RFL24308HF |
Product Overview : | Recombinant Full Length Human Claudin-5(CLDN5) Protein (O00501) (1-218aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length (1-218) |
Form : | Lyophilized powder |
AA Sequence : | MGSAALEILGLVLCLVGWGGLILACGLPMWQVTAFLDHNIVTAQTTWKGLWMSCVVQSTGHMQCKVYDSVLALSTEVQAARALTVSAVLLAFVALFVTLAGAQCTTCVAPGPAKARVALTGGVLYLFCGLLALVPLCWFANIVVREFYDPSVPVSQKYELGAALYIGWAATALLMVGGCLLCCGAWVCTGRPDLSFPVKYSAPRRPTATGDYDKKNYV |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Applications : | SDS-PAGE |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CLDN5 |
Synonyms | CLDN5; AWAL; TMVCF; Claudin-5; Transmembrane protein deleted in VCFS; TMDVCF |
UniProt ID | O00501 |
◆ Recombinant Proteins | ||
CLDN5-1734M | Recombinant Mouse CLDN5 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN5-15H | Recombinant Human CLDN5 protein, GST-tagged | +Inquiry |
RFL13261RF | Recombinant Full Length Rat Claudin-5(Cldn5) Protein, His-Tagged | +Inquiry |
Cldn5-795M | Recombinant Mouse Cldn5 Protein, His-tagged | +Inquiry |
CLDN5-2790H | Recombinant Human CLDN5 Protein, His-tagged, OVA Conjugated | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN5-7461HCL | Recombinant Human CLDN5 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN5 Products
Required fields are marked with *
My Review for All CLDN5 Products
Required fields are marked with *
0
Inquiry Basket