Recombinant Full Length Human CLDN1 Protein, C-Flag-tagged
Cat.No. : | CLDN1-1419HFL |
Product Overview : | Recombinant Full Length Human CLDN1 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Tight junctions represent one mode of cell-to-cell adhesion in epithelial or endothelial cell sheets, forming continuous seals around cells and serving as a physical barrier to prevent solutes and water from passing freely through the paracellular space. These junctions are comprised of sets of continuous networking strands in the outwardly facing cytoplasmic leaflet, with complementary grooves in the inwardly facing extracytoplasmic leaflet. The protein encoded by this gene, a member of the claudin family, is an integral membrane protein and a component of tight junction strands. Loss of function mutations result in neonatal ichthyosis-sclerosing cholangitis syndrome. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.6 kDa |
AA Sequence : | MANAGLQLLGFILAFLGWIGAIVSTALPQWRIYSYAGDNIVTAQAMYEGLWMSCVSQSTGQIQCKVFDSL LNLSSTLQATRALMVVGILLGVIAIFVATVGMKCMKCLEDDEVQKMRMAVIGGAIFLLAGLAILVATAWY GNRIVQEFYDPMTPVNARYEFGQALFTGWAAASLCLLGGALLCCSCPRKTTSYPTPRPYPKPAPSSGKDY VTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Transmembrane |
Protein Pathways : | Cell adhesion molecules (CAMs), Leukocyte transendothelial migration, Pathogenic Escherichia coli infection, Tight junction |
Full Length : | Full L. |
Gene Name | CLDN1 claudin 1 [ Homo sapiens (human) ] |
Official Symbol | CLDN1 |
Synonyms | CLD1; SEMP1; ILVASC |
Gene ID | 9076 |
mRNA Refseq | NM_021101.5 |
Protein Refseq | NP_066924.1 |
MIM | 603718 |
UniProt ID | O95832 |
◆ Recombinant Proteins | ||
CLDN1-0081H | Recombinant Human CLDN1 Protein (Met1-Val211), C-His-tagged | +Inquiry |
CLDN1-11282H | Recombinant Human CLDN1 Protein, His-tagged | +Inquiry |
CLDN1-2173C | Recombinant Chicken CLDN1 | +Inquiry |
CLDN1-890R | Recombinant Rhesus monkey CLDN1 Protein, His-tagged | +Inquiry |
RFL25672RF | Recombinant Full Length Rat Claudin-1(Cldn1) Protein, His-Tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN1-7471HCL | Recombinant Human CLDN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN1 Products
Required fields are marked with *
My Review for All CLDN1 Products
Required fields are marked with *
0
Inquiry Basket