Recombinant Full Length Human CLDN10 Protein, GST-tagged
| Cat.No. : | CLDN10-2038HF |
| Product Overview : | Human CLDN10 full-length ORF ( NP_008915.1, 1 a.a. - 228 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 228 amino acids |
| Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. The expression level of this gene is associated with recurrence of primary hepatocellular carcinoma. Six alternatively spliced transcript variants encoding different isoforms have been reported, but the transcript sequences of some variants are not determined.[provided by RefSeq, Jun 2010] |
| Molecular Mass : | 50.9 kDa |
| AA Sequence : | MASTASEIIAFMVSISGWVLVSSTLPTDYWKVSTIDGTVITTATYWANLWKACVTDSTGVSNCKDFPSMLALDGYIQACRGLMIAAVSLGFFGSIFALFGMKCTKVGGSDKAKAKIACLAGIVFILSGLCSMTGCSLYANKITTEFFDPLFVEQKYELGAALFIGWAGASLCIIGGVIFCFSISDNNKTPRYTYNGATSVMSSRTKYHGGEDFKTTNPSKQFDKNAYV |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLDN10 claudin 10 [ Homo sapiens ] |
| Official Symbol | CLDN10 |
| Synonyms | CLDN10; claudin 10; claudin-10; CPETRL3; OSP L; OSP-like protein; OSP-L |
| Gene ID | 9071 |
| mRNA Refseq | NM_001160100 |
| Protein Refseq | NP_001153572 |
| MIM | 617579 |
| UniProt ID | P78369 |
| ◆ Recombinant Proteins | ||
| CLDN10-1426H | Recombinant Human CLDN10 Protein, GST-tagged | +Inquiry |
| RFL12169HF | Recombinant Full Length Human Claudin-10(Cldn10) Protein, His-Tagged | +Inquiry |
| CLDN10-5130C | Recombinant Chicken CLDN10 | +Inquiry |
| CLDN10-5129C | Recombinant Chicken CLDN10 | +Inquiry |
| CLDN10-2038HF | Recombinant Full Length Human CLDN10 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLDN10-362HCL | Recombinant Human CLDN10 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLDN10 Products
Required fields are marked with *
My Review for All CLDN10 Products
Required fields are marked with *
