Recombinant Full Length Human CLDN15 Protein, GST-tagged

Cat.No. : CLDN15-2042HF
Product Overview : Human CLDN15 full-length ORF ( AAH10160, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 128 amino acids
Description : This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010]
Molecular Mass : 39.82 kDa
AA Sequence : MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGSTDSPASLSGGTGLLVRLMSIKGPCEGRRLASCRLSVRCKEAVCVQGIFRPAGHS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CLDN15 claudin 15 [ Homo sapiens ]
Official Symbol CLDN15
Synonyms CLDN15; claudin 15; claudin-15; FLJ42715; MGC19536
Gene ID 24146
mRNA Refseq NM_001185080
Protein Refseq NP_001172009
MIM 615778
UniProt ID P56746

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLDN15 Products

Required fields are marked with *

My Review for All CLDN15 Products

Required fields are marked with *

0
cart-icon
0
compare icon