Recombinant Human CLDN15 Protein, GST-tagged
Cat.No. : | CLDN15-1432H |
Product Overview : | Human CLDN15 full-length ORF ( AAH10160, 1 a.a. - 128 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | This gene encodes a member of the claudin family. Claudins are integral membrane proteins and components of tight junction strands. Tight junction strands serve as a physical barrier to prevent solutes and water from passing freely through the paracellular space between epithelial or endothelial cell sheets, and also play critical roles in maintaining cell polarity and signal transductions. Alternatively spliced transcript variants encoding the same protein have been found for this gene. [provided by RefSeq, Jun 2010] |
Molecular Mass : | 39.82 kDa |
AA Sequence : | MSMAVETFGFFMATVGLLMLGVTLPNSYWRVSTVHGNVITTNTIFENLWFSCATDSLGVYNCWEFPSMLALSGSTDSPASLSGGTGLLVRLMSIKGPCEGRRLASCRLSVRCKEAVCVQGIFRPAGHS |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CLDN15 claudin 15 [ Homo sapiens ] |
Official Symbol | CLDN15 |
Synonyms | CLDN15; claudin 15; claudin-15; FLJ42715; MGC19536; |
Gene ID | 24146 |
mRNA Refseq | NM_001185080 |
Protein Refseq | NP_001172009 |
MIM | 615778 |
UniProt ID | P56746 |
◆ Recombinant Proteins | ||
CLDN15-3526M | Recombinant Mouse CLDN15 Protein | +Inquiry |
CLDN15-1090R | Recombinant Rat CLDN15 Protein, His (Fc)-Avi-tagged | +Inquiry |
CLDN15-1432R | Recombinant Rat CLDN15 Protein | +Inquiry |
RFL23412BF | Recombinant Full Length Bovine Claudin-15(Cldn15) Protein, His-Tagged | +Inquiry |
CLDN15-1432H | Recombinant Human CLDN15 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLDN15-7469HCL | Recombinant Human CLDN15 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CLDN15 Products
Required fields are marked with *
My Review for All CLDN15 Products
Required fields are marked with *
0
Inquiry Basket