Recombinant Full Length Human CLEC2D Protein, C-Flag-tagged
Cat.No. : | CLEC2D-612HFL |
Product Overview : | Recombinant Full Length Human CLEC2D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 22.1 kDa |
AA Sequence : | MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Transmembrane |
Full Length : | Full L. |
Gene Name | CLEC2D C-type lectin domain family 2 member D [ Homo sapiens (human) ] |
Official Symbol | CLEC2D |
Synonyms | CLAX; LLT1; OCIL |
Gene ID | 29121 |
mRNA Refseq | NM_001004419.5 |
Protein Refseq | NP_001004419.1 |
MIM | 605659 |
UniProt ID | Q9UHP7 |
◆ Recombinant Proteins | ||
CLEC2D-1464H | Recombinant Human CLEC2D Protein, GST-tagged | +Inquiry |
CLEC2D-1438R | Recombinant Rat CLEC2D Protein | +Inquiry |
CLEC2D-3236H | Recombinant Human CLEC2D Protein, MYC/DDK-tagged | +Inquiry |
CLEC2D-2133HF | Recombinant Full Length Human CLEC2D Protein, GST-tagged | +Inquiry |
CLEC2D-6077H | Recombinant Human CLEC2D Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CLEC2D-737RCL | Recombinant Rat CLEC2D cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2D Products
Required fields are marked with *
My Review for All CLEC2D Products
Required fields are marked with *