Recombinant Full Length Human CLEC2D Protein, C-Flag-tagged
| Cat.No. : | CLEC2D-612HFL |
| Product Overview : | Recombinant Full Length Human CLEC2D Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a member of the natural killer cell receptor C-type lectin family. The encoded protein inhibits osteoclast formation and contains a transmembrane domain near the N-terminus as well as the C-type lectin-like extracellular domain. Several alternatively spliced transcript variants have been identified for this gene. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 22.1 kDa |
| AA Sequence : | MHDSNNVEKDITPSELPANPGCLHSKEHSIKATLIWRLFFLIMFLTIIVCGMVAALSAIRANCHQEPSVC LQAACPESWIGFQRKCFYFSDDTKNWTSSQRFCDSQDADLAQVESFQELNFLLRYKGPSDHWIGLSREQG QPWKWINGTEWTRQLVMKEDGANLYVAKVSQVPRMNPRPVMVSYPGSRRVCLFETRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Protein Families : | Druggable Genome, Transmembrane |
| Full Length : | Full L. |
| Gene Name | CLEC2D C-type lectin domain family 2 member D [ Homo sapiens (human) ] |
| Official Symbol | CLEC2D |
| Synonyms | CLAX; LLT1; OCIL |
| Gene ID | 29121 |
| mRNA Refseq | NM_001004419.5 |
| Protein Refseq | NP_001004419.1 |
| MIM | 605659 |
| UniProt ID | Q9UHP7 |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLEC2D Products
Required fields are marked with *
My Review for All CLEC2D Products
Required fields are marked with *



