Recombinant Full Length Human CLIC2 Protein, GST-tagged
| Cat.No. : | CLIC2-2179HF |
| Product Overview : | Human CLIC2 full-length ORF ( AAH22305, 1 a.a. - 247 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 247 amino acids |
| Description : | This gene encodes a chloride intracellular channel protein. Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. This protein plays a role in inhibiting the function of ryanodine receptor 2. A mutation in this gene is the cause of an X-linked form of cognitive disability. [provided by RefSeq, Jul 2017] |
| Molecular Mass : | 52.91 kDa |
| AA Sequence : | MSGLRPGTQVDPEIELFVKAGSDGESIGNCPFCQRLFMILWLKGVKFNVTTVDMTRKPEELKDLAPGTNPPFLVYNKELKTDFIKIEEFLEQTLAPPRYPHLSPKYKESFDVGCNLFAKFSAYIKNTQKEANKNFEKSLLKEFKRLDDYLNTPLLDEIDPDSAEEPPVSRRLFLDGDQLTLADCSLLPKLNITKVAAKKYRDFDIPAEFSGVWRYLHNAYAREEFTHTCPEDKEIENTYANVAKQKS |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CLIC2 chloride intracellular channel 2 [ Homo sapiens ] |
| Official Symbol | CLIC2 |
| Synonyms | CLIC2; chloride intracellular channel 2; chloride intracellular channel protein 2; XAP121; CLIC2b |
| Gene ID | 1193 |
| mRNA Refseq | NM_001289 |
| Protein Refseq | NP_001280 |
| MIM | 300138 |
| UniProt ID | O15247 |
| ◆ Recombinant Proteins | ||
| CLIC2-734R | Recombinant Rhesus Macaque CLIC2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CLIC2-1449R | Recombinant Rat CLIC2 Protein | +Inquiry |
| CLIC2-2786C | Recombinant Chicken CLIC2 | +Inquiry |
| CLIC2-3907H | Recombinant Human CLIC2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| CLIC2-3512H | Recombinant Human Chloride Intracellular Channel 2, His-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CLIC2-7447HCL | Recombinant Human CLIC2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLIC2 Products
Required fields are marked with *
My Review for All CLIC2 Products
Required fields are marked with *



