Recombinant Full Length Human CLIC4 Protein, C-Flag-tagged

Cat.No. : CLIC4-1647HFL
Product Overview : Recombinant Full Length Human CLIC4 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Mammalian Cells
Tag : Flag
Description : Chloride channels are a diverse group of proteins that regulate fundamental cellular processes including stabilization of cell membrane potential, transepithelial transport, maintenance of intracellular pH, and regulation of cell volume. Chloride intracellular channel 4 (CLIC4) protein, encoded by the CLIC4 gene, is a member of the p64 family; the gene is expressed in many tissues and exhibits a intracellular vesicular pattern in Panc-1 cells (pancreatic cancer cells).
Form : 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol.
Molecular Mass : 28.6 kDa
AA Sequence : MALSMPLNGLKEEDKEPLIELFVKAGSDGESIGNCPFSQRLFMILWLKGVVFSVTTVDLKRKPADLQNLA PGTHPPFITFNSEVKTDVNKIEEFLEEVLCPPKYLKLSPKHPESNTAGMDIFAKFSAYIKNSRPEANEAL ERGLLKTLQKLDEYLNSPLPDEIDENSMEDIKFSTRKFLDGNEMTLADCNLLPKLHIVKVVAKKYRNFDI
PKEMTGIWRYLTNAYSRDEFTNTCPSDKEVEIAYSDVAKRLTKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining.
Stability : Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles.
Storage : Store at -80 centigrade.
Concentration : >50 ug/mL as determined by microplate BCA method.
Preparation : Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps.
Protein Families : Druggable Genome, Ion Channels: Other
Full Length : Full L.
Gene Name CLIC4 chloride intracellular channel 4 [ Homo sapiens (human) ]
Official Symbol CLIC4
Synonyms H1; huH1; p64H1; CLIC4L; MTCLIC
Gene ID 25932
mRNA Refseq NM_013943.3
Protein Refseq NP_039234.1
MIM 606536
UniProt ID Q9Y696

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CLIC4 Products

Required fields are marked with *

My Review for All CLIC4 Products

Required fields are marked with *

0
cart-icon
0
compare icon