Recombinant Full Length Human CLNS1A Protein, GST-tagged
| Cat.No. : | CLNS1A-1885HF | 
| Product Overview : | Human CLNS1A full-length ORF ( NP_001284, 1 a.a. - 237 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 237 amino acids | 
| Description : | This gene encodes a protein that functions in multiple regulatory pathways. The encoded protein complexes with numerous cytosolic proteins and performs diverse functions including regulation of small nuclear ribonucleoprotein biosynthesis, platelet activation and cytoskeletal organization. The protein is also found associated with the plasma membrane where it functions as a chloride current regulator. Pseudogenes of this gene are found on chromosomes 1, 4 and 6. Several transcript variants encoding different isoforms have been found for this gene. [provided by RefSeq, Jul 2015] | 
| Molecular Mass : | 51.7 kDa | 
| AA Sequence : | MSFLKSFPPPGPAEGLLRQQPDTEAVLNGKGLGTGTLYIAESRLSWLDGSGLGFSLEYPTISLHALSRDRSDCLGEHLYVMVNAKFEEESKEPVADEEEEDSDDDVEPITEFRFVPSDKSALEAMFTAMCECQALHPDPEDEDSDDYDGEEYDVEAHEQGQGDIPTFYTYEEGLSHLTAEGQATLERLEGMLSQSVSSQYNMAGVRTEDSIRDYEDGMEVDTTPTVAGQFEDADVDH | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | CLNS1A chloride channel, nucleotide-sensitive, 1A [ Homo sapiens ] | 
| Official Symbol | CLNS1A | 
| Synonyms | CLNS1A; chloride channel, nucleotide-sensitive, 1A; CLCI; methylosome subunit pICln; ICln; i(Cln); reticulocyte pICln; reticulocyte protein ICln; chloride channel regulatory protein; chloride ion current inducer protein; chloride channel, nucleotide sensitive 1A; chloride conductance regulatory protein ICln; CLNS1B | 
| Gene ID | 1207 | 
| mRNA Refseq | NM_001293 | 
| Protein Refseq | NP_001284 | 
| MIM | 602158 | 
| UniProt ID | P54105 | 
| ◆ Recombinant Proteins | ||
| CLNS1A-1885HF | Recombinant Full Length Human CLNS1A Protein, GST-tagged | +Inquiry | 
| CLNS1A-360H | Recombinant Human chloride channel, nucleotide-sensitive, 1A, His-tagged | +Inquiry | 
| CLNS1A-535R | Recombinant Rabbit CLNS1A protein, His&Myc-tagged | +Inquiry | 
| CLNS1A-3743H | Recombinant Human CLNS1A protein, GST-tagged | +Inquiry | 
| CLNS1A-27276TH | Recombinant Human CLNS1A, His-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| CLNS1A-7437HCL | Recombinant Human CLNS1A 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CLNS1A Products
Required fields are marked with *
My Review for All CLNS1A Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            