Recombinant Full Length Human CMTM2 Protein, GST-tagged

Cat.No. : CMTM2-1907HF
Product Overview : Human CMTM2 full-length ORF ( NP_653274.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 248 amino acids
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. [provided by RefSeq, Jul 2008]
Molecular Mass : 53.9 kDa
AA Sequence : MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMTM2 CKLF-like MARVEL transmembrane domain containing 2 [ Homo sapiens ]
Official Symbol CMTM2
Synonyms CMTM2; CKLF-like MARVEL transmembrane domain containing 2; chemokine like factor super family 2 , chemokine like factor superfamily 2 , CKLFSF2; CKLF-like MARVEL transmembrane domain-containing protein 2; FLJ25732; MGC39436; chemokine-like factor superfamily 2; chemokine-like factor superfamily member 2; CKLFSF2
Gene ID 146225
mRNA Refseq NM_001199317
Protein Refseq NP_001186246
MIM 607885
UniProt ID Q8TAZ6

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMTM2 Products

Required fields are marked with *

My Review for All CMTM2 Products

Required fields are marked with *

0
cart-icon