Recombinant Full Length Human CMTM2 Protein, GST-tagged
| Cat.No. : | CMTM2-1907HF |
| Product Overview : | Human CMTM2 full-length ORF ( NP_653274.1, 1 a.a. - 248 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 248 amino acids |
| Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development. [provided by RefSeq, Jul 2008] |
| Molecular Mass : | 53.9 kDa |
| AA Sequence : | MAPKAAKGAKPEPAPAPPPPGAKPEEDKKDGKEPSDKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLLGHAEIKIRSLGCLIAAMILLSSLTVHPILRLIITMEISFFSFFILLYSFAIHRYIPFILWPISDLFNDLIACAFLVGAVVFAVRSRRSMNLHYLLAVILIGAAGVFAFIDVCLQRNHFRGKKAKKHMLVPPPGKEKGPQQGKGPEPAKPPEPGKPPGPAKGKK |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CMTM2 CKLF-like MARVEL transmembrane domain containing 2 [ Homo sapiens ] |
| Official Symbol | CMTM2 |
| Synonyms | CMTM2; CKLF-like MARVEL transmembrane domain containing 2; chemokine like factor super family 2 , chemokine like factor superfamily 2 , CKLFSF2; CKLF-like MARVEL transmembrane domain-containing protein 2; FLJ25732; MGC39436; chemokine-like factor superfamily 2; chemokine-like factor superfamily member 2; CKLFSF2 |
| Gene ID | 146225 |
| mRNA Refseq | NM_001199317 |
| Protein Refseq | NP_001186246 |
| MIM | 607885 |
| UniProt ID | Q8TAZ6 |
| ◆ Recombinant Proteins | ||
| CMTM2-11367H | Recombinant Human CMTM2, GST-tagged | +Inquiry |
| CMTM2-1907HF | Recombinant Full Length Human CMTM2 Protein, GST-tagged | +Inquiry |
| CMTM2-1544H | Recombinant Human CMTM2 Protein, GST-tagged | +Inquiry |
| RFL33449HF | Recombinant Full Length Human Cklf-Like Marvel Transmembrane Domain-Containing Protein 2(Cmtm2) Protein, His-Tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CMTM2-7419HCL | Recombinant Human CMTM2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CMTM2 Products
Required fields are marked with *
My Review for All CMTM2 Products
Required fields are marked with *
