Recombinant Full Length Human CMTM5 Protein, GST-tagged

• Cat.No.: CMTM5-1863HF
• Product Overview: Human CKLFSF5 full-length ORF ( AAH13109, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 156 amino acids
• Description: This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
• Molecular Mass: 42.9 kDa
• AA Sequence: MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CMTM5 CKLF-like MARVEL transmembrane domain containing 5 [ Homo sapiens ]
• Official Symbol: CMTM5
• Synonyms: CMTM5; CKLF-like MARVEL transmembrane domain containing 5; chemokine like factor super family 5 , chemokine like factor superfamily 5 , CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; FLJ37521; chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLFSF5
• Gene ID: 116173
• mRNA Refseq: NM_001037288
• Protein Refseq: NP_001032365
• MIM: 607888
• UniProt ID: Q96DZ9