Recombinant Full Length Human CMTM5 Protein, GST-tagged

Cat.No. : CMTM5-1863HF
Product Overview : Human CKLFSF5 full-length ORF ( AAH13109, 1 a.a. - 156 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 156 amino acids
Description : This gene encodes a member of the chemokine-like factor superfamily. This family of genes encodes multi-pass membrane proteins that are similar to both the chemokine and the transmembrane 4 superfamilies of signaling molecules. The encoded protein may exhibit tumor suppressor activity. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jan 2014]
Molecular Mass : 42.9 kDa
AA Sequence : MLSARDRRDRHPEEGVVAELQGFAVDKAFLTSHKGILLETELALTLIIFICFTASISAYMAAALLEFFITLAFLFLYATQYYQRFDRINWPCLDFLRCVSAIIIFLVVSFAAVTSRDGAAIAAFVFGIILVSIFAYDAFKIYRTEMAPGASQGDQQ
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMTM5 CKLF-like MARVEL transmembrane domain containing 5 [ Homo sapiens ]
Official Symbol CMTM5
Synonyms CMTM5; CKLF-like MARVEL transmembrane domain containing 5; chemokine like factor super family 5 , chemokine like factor superfamily 5 , CKLFSF5; CKLF-like MARVEL transmembrane domain-containing protein 5; FLJ37521; chemokine-like factor super family 5; chemokine-like factor superfamily member 5; CKLFSF5
Gene ID 116173
mRNA Refseq NM_001037288
Protein Refseq NP_001032365
MIM 607888
UniProt ID Q96DZ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMTM5 Products

Required fields are marked with *

My Review for All CMTM5 Products

Required fields are marked with *

0
cart-icon