Recombinant Full Length Human CMTM7 Protein, GST-tagged
Cat.No. : | CMTM7-1864HF |
Product Overview : | Human CKLFSF7 full-length ORF ( AAH10116, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 175 amino acids |
Description : | This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016] |
Molecular Mass : | 44.99 kDa |
AA Sequence : | MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CMTM7 CKLF-like MARVEL transmembrane domain containing 7 [ Homo sapiens ] |
Official Symbol | CMTM7 |
Synonyms | CMTM7; CKLF-like MARVEL transmembrane domain containing 7; chemokine like factor super family 7 , chemokine like factor superfamily 7 , CKLFSF7; CKLF-like MARVEL transmembrane domain-containing protein 7; FLJ30992; chemokine-like factor superfamily 7; chemokine-like factor super family 7; chemokine-like factor superfamily member 7; chemokine-like factor super family member 7 variant 2; CKLFSF7 |
Gene ID | 112616 |
mRNA Refseq | NM_138410 |
Protein Refseq | NP_612419 |
MIM | 607890 |
UniProt ID | Q96FZ5 |
◆ Cell & Tissue Lysates | ||
CMTM7-7415HCL | Recombinant Human CMTM7 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CMTM7 Products
Required fields are marked with *
My Review for All CMTM7 Products
Required fields are marked with *
0
Inquiry Basket