Recombinant Human CMTM7 Protein, GST-tagged

Cat.No. : CMTM7-1396H
Product Overview : Human CKLFSF7 full-length ORF ( AAH10116, 1 a.a. - 175 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : Wheat Germ
Tag : GST
Description : This gene belongs to the chemokine-like factor gene superfamily, a novel family that is similar to the chemokine and transmembrane 4 superfamilies. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 3. This gene acts as a tumor suppressor that regulates G1/S transition in the cell cycle, and epidermal growth factor receptor/protein kinase B signaling during tumor pathogenesis. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Feb 2016]
Molecular Mass : 44.99 kDa
AA Sequence : MSHGAGLVRTTCSSGSALGPGAGAAQPSASPLEGLLDLSYPRTHAALLKVAQMVTLLIAFICVRSSLWTNYSAYSYFEVVTICDLIMILAFYLVHLFRFYRVLTCISWPLSELLHYLIGTLLLLIASIVAASKSYNQSGLVAGAIFGFMATFLCMASIWLSYKISCVTQSTDAAV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CMTM7 CKLF-like MARVEL transmembrane domain containing 7 [ Homo sapiens ]
Official Symbol CMTM7
Synonyms CMTM7; CKLF-like MARVEL transmembrane domain containing 7; chemokine like factor super family 7 , chemokine like factor superfamily 7 , CKLFSF7; CKLF-like MARVEL transmembrane domain-containing protein 7; FLJ30992; chemokine-like factor superfamily 7; chemokine-like factor super family 7; chemokine-like factor superfamily member 7; chemokine-like factor super family member 7 variant 2; CKLFSF7;
Gene ID 112616
mRNA Refseq NM_138410
Protein Refseq NP_612419
MIM 607890
UniProt ID Q96FZ5

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CMTM7 Products

Required fields are marked with *

My Review for All CMTM7 Products

Required fields are marked with *

0
cart-icon
0
compare icon