Recombinant Full Length Human CNFN Protein, GST-tagged

• Cat.No.: CNFN-1917HF
• Product Overview: Human CNFN full-length ORF (BAG35016.1, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 112 amino acids
• Description: CNFN (Cornifelin) is a Protein Coding gene. An important paralog of this gene is PLAC8L1.
• Molecular Mass: 38.72 kDa
• AA Sequence: MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CNFN cornifelin [ Homo sapiens (human) ]
• Official Symbol: CNFN
• Synonyms: CNFN; cornifelin; Cornifelin; Cornefied Envelope Protein Cornefilin; PLAC8L2; cornefied envelope protein cornefilin
• Gene ID: 84518
• mRNA Refseq: NM_032488
• Protein Refseq: NP_115877
• MIM: 611764
• UniProt ID: Q9BYD5