Recombinant Human CNFN Protein, GST-tagged
Cat.No. : | CNFN-1555H |
Product Overview : | Human CNFN full-length ORF (BAG35016.1, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | CNFN (Cornifelin) is a Protein Coding gene. An important paralog of this gene is PLAC8L1. |
Molecular Mass : | 38.72 kDa |
AA Sequence : | MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CNFN cornifelin [ Homo sapiens (human) ] |
Official Symbol | CNFN |
Synonyms | CNFN; cornifelin; Cornifelin; Cornefied Envelope Protein Cornefilin; PLAC8L2; cornefied envelope protein cornefilin |
Gene ID | 84518 |
mRNA Refseq | NM_032488 |
Protein Refseq | NP_115877 |
MIM | 611764 |
UniProt ID | Q9BYD5 |
◆ Recombinant Proteins | ||
CNFN-1796M | Recombinant Mouse CNFN Protein, His (Fc)-Avi-tagged | +Inquiry |
CNFN-1917HF | Recombinant Full Length Human CNFN Protein, GST-tagged | +Inquiry |
CNFN-3643M | Recombinant Mouse CNFN Protein | +Inquiry |
CNFN-1374Z | Recombinant Zebrafish CNFN | +Inquiry |
CNFN-1555H | Recombinant Human CNFN Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CNFN-7413HCL | Recombinant Human CNFN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CNFN Products
Required fields are marked with *
My Review for All CNFN Products
Required fields are marked with *
0
Inquiry Basket