Recombinant Human CNFN Protein, GST-tagged
| Cat.No. : | CNFN-1555H |
| Product Overview : | Human CNFN full-length ORF (BAG35016.1, 1 a.a. - 112 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Wheat Germ |
| Tag : | GST |
| Description : | CNFN (Cornifelin) is a Protein Coding gene. An important paralog of this gene is PLAC8L1. |
| Molecular Mass : | 38.72 kDa |
| AA Sequence : | MSYPVTSQPQCATTSCYQTQLSDWHTGLTDCCNDMPVCLCGTFAPLCLACRISDDFGECCCAPYLPGGLHSIRTGMRERYHIQGSVGHDWAALTFCLPCALCQMARELKIRE |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNFN cornifelin [ Homo sapiens (human) ] |
| Official Symbol | CNFN |
| Synonyms | CNFN; cornifelin; Cornifelin; Cornefied Envelope Protein Cornefilin; PLAC8L2; cornefied envelope protein cornefilin |
| Gene ID | 84518 |
| mRNA Refseq | NM_032488 |
| Protein Refseq | NP_115877 |
| MIM | 611764 |
| UniProt ID | Q9BYD5 |
| ◆ Recombinant Proteins | ||
| CNFN-1796M | Recombinant Mouse CNFN Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNFN-1555H | Recombinant Human CNFN Protein, GST-tagged | +Inquiry |
| CNFN-1374Z | Recombinant Zebrafish CNFN | +Inquiry |
| CNFN-1917HF | Recombinant Full Length Human CNFN Protein, GST-tagged | +Inquiry |
| CNFN-3643M | Recombinant Mouse CNFN Protein | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNFN-7413HCL | Recombinant Human CNFN 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNFN Products
Required fields are marked with *
My Review for All CNFN Products
Required fields are marked with *
