Recombinant Full Length Human CNIH Protein, GST-tagged

Cat.No. : CNIH-1923HF
Product Overview : Human CNIH full-length ORF ( NP_005767.1, 1 a.a. - 144 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 144 amino acids
Description : CNIH1 (Cornichon Family AMPA Receptor Auxiliary Protein 1) is a Protein Coding gene. Diseases associated with CNIH1 include Schizophrenia. Among its related pathways are Transport to the Golgi and subsequent modification and Vesicle-mediated transport. An important paralog of this gene is CNIH3.
Molecular Mass : 43.1 kDa
AA Sequence : MAFTFAAFCYMLALLLTAALIFFAIWHIIAFDELKTDYKNPIDQCNTLNPLVLPEYLIHAFFCVMFLCAAEWLTLGLNMPLLAYHIWRYMSRPVMSGPGLYDPTTIMNADILAYCQKEGWCKLAFYLLAFFYYLYGMIYVLVSS
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CNIH cornichon homolog (Drosophila) [ Homo sapiens ]
Official Symbol CNIH
Synonyms CNIH; cornichon homolog (Drosophila); protein cornichon homolog; CNIH1; CNIL; TGAM77; T-cell growth-associated molecule 77; MGC117156
Gene ID 10175
mRNA Refseq NM_005776
Protein Refseq NP_005767
MIM 611287
UniProt ID O95406

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CNIH Products

Required fields are marked with *

My Review for All CNIH Products

Required fields are marked with *

0
cart-icon
0
compare icon