Recombinant Full Length Human CNIH4 Protein, GST-tagged
| Cat.No. : | CNIH4-5656HF |
| Product Overview : | Human HSPC163 full-length ORF ( AAH00573, 1 a.a. - 139 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 139 amino acids |
| Description : | CNIH4 (Cornichon Family AMPA Receptor Auxiliary Protein 4) is a Protein Coding gene. GO annotations related to this gene include CCR5 chemokine receptor binding. An important paralog of this gene is CNIH1. |
| Molecular Mass : | 41.03 kDa |
| AA Sequence : | MEAVVFVFSLLDCCALIFLSVYFIITLSDLECDYINARSCCSKLNKWVIPELIGHTIVTVLLLMSLHWFIFLLNLPVATWNIYRYIMVPSGNMGVFDPTEIHNRGQLKSHMKEAMIKLGFHLLCFFMYLYSMILALIND |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNIH4 cornichon homolog 4 (Drosophila) [ Homo sapiens ] |
| Official Symbol | CNIH4 |
| Synonyms | CNIH4; cornichon homolog 4 (Drosophila); protein cornichon homolog 4; HSPC163; |
| Gene ID | 29097 |
| mRNA Refseq | NM_014184 |
| Protein Refseq | NP_054903 |
| MIM | 617483 |
| UniProt ID | Q9P003 |
| ◆ Recombinant Proteins | ||
| CNIH4-3653M | Recombinant Mouse CNIH4 Protein | +Inquiry |
| CNIH4-056H | Recombinant Human CNIH4 Protein, HIS-tagged | +Inquiry |
| RFL20452MF | Recombinant Full Length Mouse Protein Cornichon Homolog 4(Cnih4) Protein, His-Tagged | +Inquiry |
| CNIH4-760R | Recombinant Rhesus Macaque CNIH4 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CNIH4-5656HF | Recombinant Full Length Human CNIH4 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNIH4-7407HCL | Recombinant Human CNIH4 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNIH4 Products
Required fields are marked with *
My Review for All CNIH4 Products
Required fields are marked with *



