Recombinant Full Length Human CNOT8 Protein, GST-tagged
| Cat.No. : | CNOT8-1911HF |
| Product Overview : | Human CNOT8 full-length ORF ( AAH17366, 1 a.a. - 292 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 292 amino acids |
| Description : | CNOT8 (CCR4-NOT Transcription Complex Subunit 8) is a Protein Coding gene. Among its related pathways are Deadenylation-dependent mRNA decay and Gene Expression. GO annotations related to this gene include nucleic acid binding and RNA binding. An important paralog of this gene is CNOT7. |
| Molecular Mass : | 57.86 kDa |
| AA Sequence : | MPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVVVRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQFQKHEEEGIDTLHFAELLTTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKYLMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNEDVDSAQEKMSILAIINNMQQ |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ] |
| Official Symbol | CNOT8 |
| Synonyms | CNOT8; CCR4-NOT transcription complex, subunit 8; POP2; CCR4-NOT transcription complex subunit 8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8 |
| Gene ID | 9337 |
| mRNA Refseq | NM_004779 |
| Protein Refseq | NP_004770 |
| MIM | 603731 |
| UniProt ID | Q9UFF9 |
| ◆ Recombinant Proteins | ||
| CNOT8-2327C | Recombinant Chicken CNOT8 | +Inquiry |
| CNOT8-942R | Recombinant Rhesus monkey CNOT8 Protein, His-tagged | +Inquiry |
| CNOT8-156H | Recombinant Human CNOT8 protein, T7/His-tagged | +Inquiry |
| CNOT8-207H | Recombinant Human CCR4-NOT transcription complex, subunit 8, His-tagged | +Inquiry |
| CNOT8-12645Z | Recombinant Zebrafish CNOT8 | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CNOT8-7398HCL | Recombinant Human CNOT8 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CNOT8 Products
Required fields are marked with *
My Review for All CNOT8 Products
Required fields are marked with *



