Recombinant Human CNOT8 protein, T7/His-tagged

• Cat.No.: CNOT8-156H
• Product Overview: Recombinant human POP2 (291aa, derived from BC017366) protein fused with T7-His-TEV cleavage site Tag (29aa)at N-terminal was expressed in E. coli.

Specification

• Species: Human
• Source: E.coli
• Tag: His&T7
• Form: 1.0 mg/ml, sterile-filtered, in 20 mM pH 8.0 Tris-HCl Buffer, with proprietary formulation of NaCl, KCl, EDTA, Sucrose and DTT.
• AA Sequence: MASMTGGQQMGRGHHHHHHENLYFQGGEFPAALVENSQVICEVWASNLEEEMRKIREIVLSYSYIAMDTEFPGVV VRPIGEFRSSIDYQYQLLRCNVDLLKIIQLGLTFTNEKGEYPSGINTWQFNFKFNLTEDMYSQDSIDLLANSGLQ FQKHEEEGIDTLHFAELLMTSGVVLCDNVKWLSFHSGYDFGYMVKLLTDSRLPEEEHEFFHILNLFFPSIYDVKY LMKSCKNLKGGLQEVADQLDLQRIGRQHQAGSDSLLTGMAFFRMKELFFEDSIDDAKYCGRLYGLGTGVAQKQNE DVDSAQEKMSILAIINNMQQ
• Purity: >90% by SDS-PAGE
• Applications: 1. May serve as auto-antibodies detection reagent, which will react with sera of some autoimmune-diseases patients.2. May be used as specific protein substrate for kinase and ubiquitin (Sumo pathway) related enzyme functional screening assays.3. May be used for POP2 protein-protein interaction mapping.4. As immunogen for specific antibody production.
• Storage: Keep at -80°C for long term storage. Product is stable at 4 °C for at least 7 days.

Gene Information

• Gene Name: CNOT8 CCR4-NOT transcription complex, subunit 8 [ Homo sapiens ]
• Official Symbol: CNOT8
• Synonyms: CNOT8; CAF1; CALIF; hCAF1; PGK promoter directed over production; CAF2; CALIFp; CAF1-like protein; CCR4-associated factor 8
• Gene ID: 9337
• mRNA Refseq: NM_004779
• Protein Refseq: NP_004770
• MIM: 603731
• UniProt ID: Q9UFF9
• Chromosome Location: 5q31-q33
• Pathway: Deadenylation of mRNA, organism-specific biosystem; Deadenylation-dependent mRNA decay, organism-specific biosystem; Gene Expression, organism-specific biosystem; RNA degradation, organism-specific biosystem; RNA degradation, conserved biosystem
• Function: nucleic acid binding; sequence-specific DNA binding transcription factor activity