Recombinant Full Length Human Coiled-Coil Domain-Containing Protein 90B, Mitochondrial(Ccdc90B) Protein, His-Tagged
Cat.No. : | RFL15960HF |
Product Overview : | Recombinant Full Length Human Coiled-coil domain-containing protein 90B, mitochondrial(CCDC90B) Protein (Q9GZT6) (43-254aa), fused to N-terminal His tag, was expressed in E. coli. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | Full Length of Mature Protein (43-254) |
Form : | Lyophilized powder |
AA Sequence : | GYDRRPVDITPLEQRKLTFDTHALVQDLETHGFDKTQAETIVSALTALSNVSLDTIYKEM VTQAQQEITVQQLMAHLDAIRKDMVILEKSEFANLRAENEKMKIELDQVKQQLMHETSRI RADNKLDINLERSRVTDMFTDQEKQLMETTTEFTKKDTQTKSIISETSNKIDAEIASLKT LMESNKLETIRYLAASVFTCLAIALGFYRFWK |
Purity : | Greater than 90% as determined by SDS-PAGE. |
Notes : | Repeated freezing and thawing is not recommended. Store working aliquots at 4°C for up to one week. |
Storage : | Store at -20°C/-80°C upon receipt, aliquoting is necessary for mutiple use. Avoid repeated freeze-thaw cycles. |
Storage Buffer : | Tris/PBS-based buffer, 6% Trehalose, pH 8.0 |
Reconstitution : | We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20℃/-80℃. Our default final concentration of glycerol is 50%. Customers could use it as reference. |
Gene Name | CCDC90B |
Synonyms | CCDC90B; CUA003; MDS011; MDS025; Coiled-coil domain-containing protein 90B, mitochondrial |
UniProt ID | Q9GZT6 |
◆ Recombinant Proteins | ||
CCDC90B-860R | Recombinant Rat CCDC90B Protein, His (Fc)-Avi-tagged | +Inquiry |
CCDC90B-7609H | Recombinant Human CCDC90B, His-tagged | +Inquiry |
CCDC90B-1381M | Recombinant Mouse CCDC90B Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL34921RF | Recombinant Full Length Rat Coiled-Coil Domain-Containing Protein 90B, Mitochondrial(Ccdc90B) Protein, His-Tagged | +Inquiry |
CCDC90B-2866H | Recombinant Human CCDC90B Protein, MYC/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CCDC90B-163HCL | Recombinant Human CCDC90B lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CCDC90B Products
Required fields are marked with *
My Review for All CCDC90B Products
Required fields are marked with *
0
Inquiry Basket