Recombinant Full Length Human COL8A2 Protein, GST-tagged

Cat.No. : COL8A2-2180HF
Product Overview : Human COL8A2 full-length ORF ( AAH96296.1, 1 a.a. - 427 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 427 amino acids
Description : This gene encodes the alpha 2 chain of type VIII collagen. This protein is a major component of the basement membrane of the corneal endothelium and forms homo- or heterotrimers with alpha 1 (VIII) type collagens. Defects in this gene are associated with Fuchs endothelial corneal dystrophy and posterior polymorphous corneal dystrophy type 2. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Jun 2014]
Molecular Mass : 68.9 kDa
AA Sequence : MLGTLTPLSSLLLLLLVLVLGCGPRASSGGGAGGAAGYAPVKYIQPMQKGPVGPPFREGKGQYLEMPLPLLPMDLKGEPGPPGKPGPRGPPGPPGFPGKPGMGKPGLHGQPGPAGPPGFSRMGKAGPPGLPGKVGPPGQPGLRGEPGIRGDQGLRGPPGPPGLPGPSGITIPGKPGAQGVPGPPGFQGEPGPQGEPGPPGDRGLKGDNGVGQPGLPGAPGQGGAPGPPGLPGPAGLGKPGLDGLPGAPGDKGESGPPGAFDETGIAGLHLPNGGVEGAVLGKGGKPQFGLGELSAHATPAFTAVLTSPFPASGMPVKFDRTLYNGHSGYNPATGIFTCPVGGVYYFAYHVHVKGTNVWVALYKNNVPATYTYDEYKKGYLDQASGGAVLQLRPNDQVWVQMPSDQANGLYSTEYIHSSFSGFLLCPT
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COL8A2 collagen, type VIII, alpha 2 [ Homo sapiens ]
Official Symbol COL8A2
Synonyms COL8A2; collagen, type VIII, alpha 2; FECD; collagen alpha-2(VIII) chain; PPCD; PPCD2; endothelial collagen; collagen VIII, alpha-2 polypeptide; dJ665N4.1 (collagen type VIII alpha 2); FECD1; FLJ00201; MGC116970; MGC116972
Gene ID 1296
mRNA Refseq NM_005202
Protein Refseq NP_005193
MIM 120252
UniProt ID P25067

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COL8A2 Products

Required fields are marked with *

My Review for All COL8A2 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon