Recombinant Full Length Human COMMD6 Protein, GST-tagged

Cat.No. : COMMD6-1943HF
Product Overview : Human COMMD6 full-length ORF ( ADR83450.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 85 amino acids
Description : COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009]
Molecular Mass : 9.4 kDa
AA Sequence : MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COMMD6 COMM domain containing 6 [ Homo sapiens (human) ]
Official Symbol COMMD6
Synonyms COMMD6; COMM domain containing 6; COMM Domain Containing 6; Acrg Embryonic Lethality Minimal Region Ortholog; COMM Domain-Containing Protein 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog
Gene ID 170622
mRNA Refseq NM_001287392
Protein Refseq NP_001274321
MIM 612377
UniProt ID Q7Z4G1

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COMMD6 Products

Required fields are marked with *

My Review for All COMMD6 Products

Required fields are marked with *

0
cart-icon