Recombinant Full Length Human COMMD6 Protein, GST-tagged
| Cat.No. : | COMMD6-1943HF | 
| Product Overview : | Human COMMD6 full-length ORF ( ADR83450.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | In Vitro Cell Free System | 
| Tag : | GST | 
| Protein Length : | 85 amino acids | 
| Description : | COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009] | 
| Molecular Mass : | 9.4 kDa | 
| AA Sequence : | MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV | 
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array | 
| Notes : | Best use within three months from the date of receipt of this protein. | 
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. | 
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. | 
| Gene Name | COMMD6 COMM domain containing 6 [ Homo sapiens (human) ] | 
| Official Symbol | COMMD6 | 
| Synonyms | COMMD6; COMM domain containing 6; COMM Domain Containing 6; Acrg Embryonic Lethality Minimal Region Ortholog; COMM Domain-Containing Protein 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog | 
| Gene ID | 170622 | 
| mRNA Refseq | NM_001287392 | 
| Protein Refseq | NP_001274321 | 
| MIM | 612377 | 
| UniProt ID | Q7Z4G1 | 
| ◆ Recombinant Proteins | ||
| COMMD6-7888H | Recombinant Human COMMD6 protein, His-tagged | +Inquiry | 
| COMMD6-790R | Recombinant Rhesus Macaque COMMD6 Protein, His (Fc)-Avi-tagged | +Inquiry | 
| COMMD6-965R | Recombinant Rhesus monkey COMMD6 Protein, His-tagged | +Inquiry | 
| Commd6-2251M | Recombinant Mouse Commd6 Protein, Myc/DDK-tagged | +Inquiry | 
| COMMD6-7887H | Recombinant Human COMMD6 protein, GST-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| COMMD6-7368HCL | Recombinant Human COMMD6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD6 Products
Required fields are marked with *
My Review for All COMMD6 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            