Recombinant Full Length Human COMMD6 Protein, GST-tagged
Cat.No. : | COMMD6-1943HF |
Product Overview : | Human COMMD6 full-length ORF ( ADR83450.1, 1 a.a. - 85 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 85 amino acids |
Description : | COMMD6 belongs to a family of NF-kappa-B (see RELA; MIM 164014)-inhibiting proteins characterized by the presence of a COMM domain (see COMMD1; MIM 607238) (de Bie et al., 2006 [PubMed 16573520]).[supplied by OMIM, Mar 2009] |
Molecular Mass : | 9.4 kDa |
AA Sequence : | MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMMD6 COMM domain containing 6 [ Homo sapiens (human) ] |
Official Symbol | COMMD6 |
Synonyms | COMMD6; COMM domain containing 6; COMM Domain Containing 6; Acrg Embryonic Lethality Minimal Region Ortholog; COMM Domain-Containing Protein 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog |
Gene ID | 170622 |
mRNA Refseq | NM_001287392 |
Protein Refseq | NP_001274321 |
MIM | 612377 |
UniProt ID | Q7Z4G1 |
◆ Recombinant Proteins | ||
COMMD6-1683H | Recombinant Human COMMD6 Protein, GST-tagged | +Inquiry |
COMMD6-965R | Recombinant Rhesus monkey COMMD6 Protein, His-tagged | +Inquiry |
COMMD6-7887H | Recombinant Human COMMD6 protein, GST-tagged | +Inquiry |
COMMD6-7888H | Recombinant Human COMMD6 protein, His-tagged | +Inquiry |
Commd6-2251M | Recombinant Mouse Commd6 Protein, Myc/DDK-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMMD6-7368HCL | Recombinant Human COMMD6 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMMD6 Products
Required fields are marked with *
My Review for All COMMD6 Products
Required fields are marked with *
0
Inquiry Basket