Recombinant Human COMMD6 Protein, Myc/DDK-tagged, C13 and N15-labeled
| Cat.No. : | COMMD6-5908H | 
| Product Overview : | COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells. | 
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human | 
| Source : | HEK293 | 
| Tag : | DDK&Myc | 
| Description : | COMMD6 belongs to a family of NF-kappa-B (see RELA)-inhibiting proteins characterized by the presence of a COMM domain. | 
| Molecular Mass : | 9.6 kDa | 
| AA Sequence : | MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETVTRTRPLEQKLISEEDLAANDILDYKDDDDKV | 
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining | 
| Stability : | Stable for 3 months from receipt of products under proper storage and handling conditions. | 
| Storage : | Store at -80 centigrade. Avoid repeated freeze-thaw cycles. | 
| Concentration : | 50 μg/mL as determined by BCA | 
| Storage Buffer : | 100 mM glycine, 25 mM Tris-HCl, pH 7.3. | 
| Gene Name | COMMD6 COMM domain containing 6 [ Homo sapiens (human) ] | 
| Official Symbol | COMMD6 | 
| Synonyms | COMMD6; COMM domain containing 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog | 
| Gene ID | 170622 | 
| mRNA Refseq | NM_203495 | 
| Protein Refseq | NP_987091 | 
| MIM | 612377 | 
| UniProt ID | Q7Z4G1 | 
| ◆ Recombinant Proteins | ||
| COMMD6-965R | Recombinant Rhesus monkey COMMD6 Protein, His-tagged | +Inquiry | 
| COMMD6-7888H | Recombinant Human COMMD6 protein, His-tagged | +Inquiry | 
| COMMD6-1943HF | Recombinant Full Length Human COMMD6 Protein, GST-tagged | +Inquiry | 
| COMMD6-5908H | Recombinant Human COMMD6 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry | 
| Commd6-2251M | Recombinant Mouse Commd6 Protein, Myc/DDK-tagged | +Inquiry | 
| ◆ Cell & Tissue Lysates | ||
| COMMD6-7368HCL | Recombinant Human COMMD6 293 Cell Lysate | +Inquiry | 
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COMMD6 Products
Required fields are marked with *
My Review for All COMMD6 Products
Required fields are marked with *
 
  
        
    
       
                         
                             
            