Recombinant Human COMMD6 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: COMMD6-5908H
• Product Overview: COMMD6 MS Standard C13 and N15-labeled recombinant protein (NP_987091) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: COMMD6 belongs to a family of NF-kappa-B (see RELA)-inhibiting proteins characterized by the presence of a COMM domain.
• Molecular Mass: 9.6 kDa
• AA Sequence: MEASSEPPLDAKSDVTNQLVDFQWKLGMAVSSDTCRSLKYPYVAVMLKVADHSGQVKTKCFEMTIPQFQNFYRQFKEIAAVIETVTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: COMMD6 COMM domain containing 6 [ Homo sapiens (human) ]
• Official Symbol: COMMD6
• Synonyms: COMMD6; COMM domain containing 6; Acrg; COMM domain-containing protein 6; Acrg embryonic lethality minimal region ortholog
• Gene ID: 170622
• mRNA Refseq: NM_203495
• Protein Refseq: NP_987091
• MIM: 612377
• UniProt ID: Q7Z4G1