Recombinant Full Length Human COMP Protein, GST-tagged
Cat.No. : | COMP-1947HF |
Product Overview : | Human COMP full-length ORF (BAC11031.1, 1 a.a. - 130 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 130 amino acids |
Description : | The protein encoded by this gene is a noncollagenous extracellular matrix (ECM) protein. It consists of five identical glycoprotein subunits, each with EGF-like and calcium-binding (thrombospondin-like) domains. Oligomerization results from formation of a five-stranded coiled coil and disulfides. Binding to other ECM proteins such as collagen appears to depend on divalent cations. Contraction or expansion of a 5 aa aspartate repeat and other mutations can cause pseudochondroplasia (PSACH) and multiple epiphyseal dysplasia (MED). [provided by RefSeq, Jul 2016] |
Molecular Mass : | 40.2 kDa |
AA Sequence : | MVPDTACVLLLTLAALGASGQGQSPLGSDLGPQMLRELQETNAALQDVRELLRQQVREITFLKNTVMECDACGMQQSVRTGLPSVRPLLHCAPGVPLRGLPAGVQRPHPPGRGAGFRQGQQAGLHGHQRV |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COMP cartilage oligomeric matrix protein [ Homo sapiens ] |
Official Symbol | COMP |
Synonyms | COMP; cartilage oligomeric matrix protein; cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple) , EDM1, EPD1, PSACH; MED; THBS5; thrombospondin 5; TSP5; thrombospondin-5; pseudoachondroplasia (epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein(pseudoachondroplasia, epiphyseal dysplasia 1, multiple); cartilage oligomeric matrix protein (pseudoachondroplasia, epiphyseal dysplasia 1, multiple); EDM1; EPD1; PSACH; MGC131819; MGC149768 |
Gene ID | 1311 |
mRNA Refseq | NM_000095 |
Protein Refseq | NP_000086 |
MIM | 600310 |
UniProt ID | P49747 |
◆ Recombinant Proteins | ||
COMP-0393B | Recombinant Bacillus subtilis COMP protein, His-tagged | +Inquiry |
COMP-01H | Recombinant Human COMP Protein, His-tagged | +Inquiry |
COMP-3658H | Recombinant Human COMP, His-tagged | +Inquiry |
COMP-3183H | Recombinant Human COMP protein, His-tagged | +Inquiry |
COMP-3770M | Recombinant Mouse COMP Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
COMP-3031HCL | Recombinant Human COMP cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COMP Products
Required fields are marked with *
My Review for All COMP Products
Required fields are marked with *
0
Inquiry Basket