Recombinant Full Length Human CORO1A Protein, C-Flag-tagged
Cat.No. : | CORO1A-1487HFL |
Product Overview : | Recombinant Full Length Human CORO1A Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | This gene encodes a member of the WD repeat protein family. WD repeats are minimally conserved regions of approximately 40 amino acids typically bracketed by gly-his and trp-asp (GH-WD), which may facilitate formation of heterotrimeric or multiprotein complexes. Members of this family are involved in a variety of cellular processes, including cell cycle progression, signal transduction, apoptosis, and gene regulation. Alternative splicing results in multiple transcript variants. A related pseudogene has been defined on chromosome 16. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 50.8 kDa |
AA Sequence : | MSRQVVRSSKFRHVFGQPAKADQCYEDVRVSQTTWDSGFCAVNPKFVALICEASGGGAFLVLPLGKTGRV DKNAPTVCGHTAPVLDIAWCPHNDNVIASGSEDCTVMVWEIPDGGLMLPLREPVVTLEGHTKRVGIVAWH TTAQNVLLSAGCDNVIMVWDVGTGAAMLTLGPEVHPDTIYSVDWSRDGGLICTSCRDKRVRIIEPRKGTV VAEKDRPHEGTRPVRAVFVSEGKILTTGFSRMSERQVALWDTKHLEEPLSLQELDTSSGVLLPFFDPDTN IVYLCGKGDSSIRYFEITSEAPFLHYLSMFSSKESQRGMGYMPKRGLEVNKCEIARFYKLHERRCEPIAM TVPRKSDLFQEDLYPPTAGPDPALTAEEWLGGRDAGPLLISLKDGYVPPKSRELRVNRGLDTGRRRAAPE ASGTPSSDAVSRLEEEMRKLQATVQELQKRLDRLEETVQAKTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Full Length : | Full L. |
Gene Name | CORO1A coronin 1A [ Homo sapiens (human) ] |
Official Symbol | CORO1A |
Synonyms | p57; IMD8; TACO; CLABP; HCORO1; CLIPINA |
Gene ID | 11151 |
mRNA Refseq | NM_007074.4 |
Protein Refseq | NP_009005.1 |
MIM | 605000 |
UniProt ID | P31146 |
◆ Recombinant Proteins | ||
CORO1A-11336Z | Recombinant Zebrafish CORO1A | +Inquiry |
CORO1A-1903M | Recombinant Mouse CORO1A Protein, His (Fc)-Avi-tagged | +Inquiry |
CORO1A-1668H | Recombinant Human CORO1A protein, His & T7-tagged | +Inquiry |
CORO1A-1715H | Recombinant Human CORO1A Protein (Arg7-Glu204), N-His tagged | +Inquiry |
CORO1A-1487HFL | Recombinant Full Length Human CORO1A Protein, C-Flag-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CORO1A-7345HCL | Recombinant Human CORO1A 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CORO1A Products
Required fields are marked with *
My Review for All CORO1A Products
Required fields are marked with *
0
Inquiry Basket