Recombinant Full Length Human COX16 Protein, GST-tagged

• Cat.No.: COX16-1998HF
• Product Overview: Human COX16 full-length ORF (AAH01702.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 106 amino acids
• Description: COX16 (COX16, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and TP53 Regulates Metabolic Genes.
• Molecular Mass: 38.06 kDa
• AA Sequence: MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: COX16 COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens (human) ]
• Official Symbol: COX16
• Synonyms: HSPC203; C14orf112; cytochrome c oxidase assembly protein; COX16 homolog, mitochondrial; cytochrome c oxidase assembly factor; COX16 cytochrome c oxidase assembly homolog (S. cerevisiae); cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; chromosome 14 open reading frame
• Gene ID: 51241
• mRNA Refseq: NM_001204090.1
• Protein Refseq: NP_001191019.1
• MIM: 618064
• UniProt ID: Q9P0S2