Recombinant Full Length Human COX16 Protein, GST-tagged
Cat.No. : | COX16-1998HF |
Product Overview : | Human COX16 full-length ORF (AAH01702.1, 1 a.a. - 106 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 106 amino acids |
Description : | COX16 (COX16, Cytochrome C Oxidase Assembly Homolog) is a Protein Coding gene. Among its related pathways are Gene Expression and TP53 Regulates Metabolic Genes. |
Molecular Mass : | 38.06 kDa |
AA Sequence : | MFAPAVMRAFRKNKTLGYGVPMLLLIVGGSFGLREFSQIRYDAVKSKMDPELEKKLKENKISLESEYEKIKDSKFDDWKNIRGPRPWEDPDLLQGRNPESLKTKTT |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX16 COX16 cytochrome c oxidase assembly homolog (S. cerevisiae) [ Homo sapiens (human) ] |
Official Symbol | COX16 |
Synonyms | HSPC203; C14orf112; cytochrome c oxidase assembly protein; COX16 homolog, mitochondrial; cytochrome c oxidase assembly factor; COX16 cytochrome c oxidase assembly homolog (S. cerevisiae); cytochrome c oxidase assembly protein COX16 homolog, mitochondrial; chromosome 14 open reading frame |
Gene ID | 51241 |
mRNA Refseq | NM_001204090.1 |
Protein Refseq | NP_001191019.1 |
MIM | 618064 |
UniProt ID | Q9P0S2 |
◆ Recombinant Proteins | ||
COX16-2723H | Recombinant Human COX16 Protein, His (Fc)-Avi-tagged | +Inquiry |
RFL17761SF | Recombinant Full Length Schizosaccharomyces Pombe Cytochrome C Oxidase Assembly Protein Cox16, Mitochondrial(Cox16) Protein, His-Tagged | +Inquiry |
COX16-4164C | Recombinant Chicken COX16 | +Inquiry |
COX16-1411H | Recombinant Human COX16 | +Inquiry |
COX16-983R | Recombinant Rhesus monkey COX16 Protein, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX16-7336HCL | Recombinant Human COX16 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX16 Products
Required fields are marked with *
My Review for All COX16 Products
Required fields are marked with *