Recombinant Full Length Human COX4I2 Protein, GST-tagged

Cat.No. : COX4I2-2004HF
Product Overview : Human COX4I2 full-length ORF ( AAH57779, 1 a.a. - 171 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 171 amino acids
Description : Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes isoform 2 of subunit IV. Isoform 1 of subunit IV is encoded by a different gene, however, the two genes show a similar structural organization. Subunit IV is the largest nuclear encoded subunit which plays a pivotal role in COX regulation. [provided by RefSeq, Jul 2008]
Molecular Mass : 44.55 kDa
AA Sequence : MLPRAAWSLVLRKGGGGRRGMHSSEGTTRGGGKMSPYTNCYAQRYYPMPEEPFCTELNAEEQALKEKEKGSWTQLTHAEKVALYRLQFNETFAEMNRRSNEWKTVMGCVFFFIGFAALVIWWQRVYVFPPKPITLTDERKAQQLQRMLDMKVNPVQGLASRWDYEKKQWKK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name COX4I2 cytochrome c oxidase subunit IV isoform 2 (lung) [ Homo sapiens ]
Official Symbol COX4I2
Synonyms COX4I2; cytochrome c oxidase subunit IV isoform 2 (lung); COX4L2, cytochrome c oxidase subunit IV isoform 2; cytochrome c oxidase subunit 4 isoform 2, mitochondrial; COX4 2; COX4B; COXIV 2; cytochrome c oxidase subunit IV like 2; dJ857M17.2; COX IV-2; cytochrome c oxidase subunit IV-like 2; COX4; COX4-2; COX4L2; COXIV-2
Gene ID 84701
mRNA Refseq NM_032609
Protein Refseq NP_115998
MIM 607976
UniProt ID Q96KJ9

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All COX4I2 Products

Required fields are marked with *

My Review for All COX4I2 Products

Required fields are marked with *

0
cart-icon