Recombinant Full Length Human COX6A1 Protein
Cat.No. : | COX6A1-91HF |
Product Overview : | Recombinant full length Human COX6A1 with N terminal proprietary tag; Predicted MW 37.73 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 109 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. |
Form : | Liquid |
Molecular Mass : | 37.730kDa inclusive of tags |
AA Sequence : | MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKT LTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIR TKPFPWGDGNHTLFHNPHVNPLPTGYEDE |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens ] |
Official Symbol | COX6A1 |
Synonyms | COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial |
Gene ID | 1337 |
mRNA Refseq | NM_004373 |
Protein Refseq | NP_004364 |
MIM | 602072 |
UniProt ID | P12074 |
◆ Recombinant Proteins | ||
Cox6a1-927M | Recombinant Mouse Cox6a1 Protein, MYC/DDK-tagged | +Inquiry |
COX6A1-3817M | Recombinant Mouse COX6A1 Protein | +Inquiry |
COX6A1-1915M | Recombinant Mouse COX6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX6A1-1753H | Recombinant Human COX6A1 Protein, GST-tagged | +Inquiry |
COX6A1-4902C | Recombinant Chicken COX6A1 | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6A1-7331HCL | Recombinant Human COX6A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX6A1 Products
Required fields are marked with *
My Review for All COX6A1 Products
Required fields are marked with *
0
Inquiry Basket