Description : |
Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. |
Source : |
In Vitro Cell Free System |
Species : |
Human |
Form : |
Liquid |
Molecular Mass : |
37.730kDa inclusive of tags |
Protein Length : |
109 amino acids |
AA Sequence : |
MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKT LTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIR TKPFPWGDGNHTLFHNPHVNPLPTGYEDE |
Purity : |
Proprietary Purification |
Storage : |
Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : |
pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |