Recombinant Full Length Human COX6A1 Protein, GST-tagged
Cat.No. : | COX6A1-2010HF |
Product Overview : | Human COX6A1 full-length ORF ( AAH07723, 1 a.a. - 109 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 109 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in the electron transfer and the nuclear-encoded subunits may function in the regulation and assembly of the complex. This nuclear gene encodes polypeptide 1 (liver isoform) of subunit VIa, and polypeptide 1 is found in all non-muscle tissues. Polypeptide 2 (heart/muscle isoform) of subunit VIa is encoded by a different gene, and is present only in striated muscles. These two polypeptides share 66% amino acid sequence identity. It has been reported that there may be several pseudogenes on chromosomes 1, 6, 7q21, 7q31-32 and 12. However, only one pseudogene (COX6A1P) on chromosome 1p31.1 has been documented. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 37.73 kDa |
AA Sequence : | MAVVGVSSVSRLLGRSRPQLGRPMSSGAHGEEGSARMWKTLTFFVALPGVAVSMLNVYLKSHHGEHERPEFIAYPHLRIRTKPFPWGDGNHTLFHNPHVNPLPTGYEDE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX6A1 cytochrome c oxidase subunit VIa polypeptide 1 [ Homo sapiens ] |
Official Symbol | COX6A1 |
Synonyms | COX6A1; cytochrome c oxidase subunit VIa polypeptide 1; COX6A; cytochrome c oxidase subunit 6A1, mitochondrial; COX VIa-L; cytochrome c oxidase subunit VIA-liver; cytochrome C oxidase subunit VIa homolog; cytochrome c oxidase polypeptide VIa-liver; COX6AL; MGC104500 |
Gene ID | 1337 |
mRNA Refseq | NM_004373 |
Protein Refseq | NP_004364 |
MIM | 602072 |
UniProt ID | P12074 |
◆ Recombinant Proteins | ||
COX6A1-4902C | Recombinant Chicken COX6A1 | +Inquiry |
COX6A1-1433Z | Recombinant Zebrafish COX6A1 | +Inquiry |
COX6A1-1915M | Recombinant Mouse COX6A1 Protein, His (Fc)-Avi-tagged | +Inquiry |
Cox6a1-927M | Recombinant Mouse Cox6a1 Protein, MYC/DDK-tagged | +Inquiry |
COX6A1-5841H | Recombinant Human COX6A1 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6A1-7331HCL | Recombinant Human COX6A1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6A1 Products
Required fields are marked with *
My Review for All COX6A1 Products
Required fields are marked with *