Recombinant Full Length Human COX6B1 Protein, GST-tagged
Cat.No. : | COX6B1-2011HF |
Product Overview : | Human COX6B1 full-length ORF ( AAH01015, 1 a.a. - 86 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 86 amino acids |
Description : | Cytochrome c oxidase (COX), the terminal enzyme of the mitochondrial respiratory chain, catalyzes the electron transfer from reduced cytochrome c to oxygen. It is a heteromeric complex consisting of 3 catalytic subunits encoded by mitochondrial genes and multiple structural subunits encoded by nuclear genes. The mitochondrially-encoded subunits function in electron transfer, and the nuclear-encoded subunits may be involved in the regulation and assembly of the complex. This nuclear gene encodes subunit VIb. Mutations in this gene are associated with severe infantile encephalomyopathy. Three pseudogenes COX6BP-1, COX6BP-2 and COX6BP-3 have been found on chromosomes 7, 17 and 22q13.1-13.2, respectively. [provided by RefSeq, Jan 2010] |
Molecular Mass : | 35.20 kDa |
AA Sequence : | MAEDMETKIKNYKTAPFDSRFPNQNQTRNCWQNYLDFHRCQKAMTAKGGDISVCEWYQRVYQSLCPTSWVTDWDEQRAEGTFPGKI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX6B1 cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous) [ Homo sapiens ] |
Official Symbol | COX6B1 |
Synonyms | COX6B1; cytochrome c oxidase subunit VIb polypeptide 1 (ubiquitous); COX6B, cytochrome c oxidase subunit Vib , cytochrome c oxidase subunit Vib polypeptide 1 (ubiquitous); cytochrome c oxidase subunit 6B1; COXG; COX VIb-1; COX6B; COXVIb1 |
Gene ID | 1340 |
mRNA Refseq | NM_001863 |
Protein Refseq | NP_001854 |
MIM | 124089 |
UniProt ID | P14854 |
◆ Recombinant Proteins | ||
Cox6b1-5300R | Recombinant Rat Cox6b1 protein, Avi-tagged, Biotinylated | +Inquiry |
Cox6b1-5302R | Recombinant Rat Cox6b1 protein | +Inquiry |
Cox6b1-5301R | Recombinant Rat Cox6b1 protein | +Inquiry |
COX6B1-1917M | Recombinant Mouse COX6B1 Protein, His (Fc)-Avi-tagged | +Inquiry |
COX6B1-11496H | Recombinant Human COX6B1, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX6B1-7329HCL | Recombinant Human COX6B1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX6B1 Products
Required fields are marked with *
My Review for All COX6B1 Products
Required fields are marked with *