Recombinant Full Length Human COX8A Protein, GST-tagged
Cat.No. : | COX8A-2043HF |
Product Overview : | Human COX8A full-length ORF ( NP_004065.1, 1 a.a. - 69 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 69 amino acids |
Description : | The protein encoded by this gene is the terminal enzyme of the respiratory chain, coupling the transfer of electrons from cytochrome c to molecular oxygen, with the concomitant production of a proton electrochemical gradient across the inner mitochondrial membrane. In addition to 3 mitochondrially encoded subunits, which perform the catalytic function, the eukaryotic enzyme contains nuclear-encoded smaller subunits, ranging in number from 4 in some organisms to 10 in mammals. It has been proposed that nuclear-encoded subunits may be involved in the modulation of the catalytic function. This gene encodes one of the nuclear-encoded subunits. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 34 kDa |
AA Sequence : | MSVLTPLLLRGLTGSARRLPVPRAKIHSLPPEGKLGIMELAVGLTSCFVTFLLPAGWILSHLETYRRPE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX8A cytochrome c oxidase subunit 8A [ Homo sapiens (human) ] |
Official Symbol | COX8A |
Synonyms | COX8A; cytochrome c oxidase subunit 8A; Cytochrome C Oxidase Subunit 8A; Cytochrome C Oxidase Polypeptide VIII-Liver/Heart; Cytochrome C Oxidase Subunit VIIIA (Ubiquitous); Cytochrome C Oxidase Subunit VIII; Cytochrome C Oxidase Subunit 8-2; COX8L; COX8; Cytochrome C Oxidase Subunit 8A, Mitochondrial; Cytochrome C Oxidase Subunit 8A (Ubiquitous); COX8-2; VIII-L; VIII; COX; cytochrome c oxidase subunit 8A, mitochondrial; cytochrome c oxidase polypeptide VIII-liver/heart; cytochrome c oxidase subunit 8-2; cytochrome c oxidase subunit 8A (ubiquitous); cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIA (ubiquitous); EC 1.9.3.1 |
Gene ID | 1351 |
mRNA Refseq | NM_004074 |
Protein Refseq | NP_004065 |
MIM | 123870 |
UniProt ID | P10176 |
◆ Recombinant Proteins | ||
COX8A-1000R | Recombinant Rhesus monkey COX8A Protein, His-tagged | +Inquiry |
COX8A-1216R | Recombinant Rat COX8A Protein, His (Fc)-Avi-tagged | +Inquiry |
COX8A-2043HF | Recombinant Full Length Human COX8A Protein, GST-tagged | +Inquiry |
COX8A-1559R | Recombinant Rat COX8A Protein | +Inquiry |
COX8A-1765H | Recombinant Human COX8A Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX8A-194HCL | Recombinant Human COX8A lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All COX8A Products
Required fields are marked with *
My Review for All COX8A Products
Required fields are marked with *
0
Inquiry Basket