Recombinant Full Length Human COX8C Protein, GST-tagged
Cat.No. : | COX8C-2044HF |
Product Overview : | Human COX8C full-length ORF ( NP_892016.1, 1 a.a. - 72 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 72 amino acids |
Description : | COX8C (Cytochrome C Oxidase Subunit 8C) is a Protein Coding gene. Among its related pathways are Respiratory electron transport, ATP synthesis by chemiosmotic coupling, and heat production by uncoupling proteins. and AMPK Enzyme Complex Pathway. GO annotations related to this gene include cytochrome-c oxidase activity. |
Molecular Mass : | 34.5 kDa |
AA Sequence : | MPLLRGRCPARRHYRRLALLGLQPAPRFAHSGPPRQRPLSAAEMAVGLVVFFTTFLTPAAYVLGNLKQFRRN |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | COX8C cytochrome c oxidase subunit 8C [ Homo sapiens (human) ] |
Official Symbol | COX8C |
Synonyms | COX8C; cytochrome c oxidase subunit 8C; Cytochrome C Oxidase Subunit 8C; Cytochrome C Oxidase Subunit VIIIC; Cytochrome C Oxidase Subunit 8-3; COX VIII-3; COX8-3; Cytochrome C Oxidase Polypeptide VIII Isoform 3; Cytochrome C Oxidase Subunit 8C, Mitochondrial; Cytochrome C Oxidase Polypeptide 8 Isoform 3; Cytochrome C Oxidase Subunit VIII Isoform 3; Cytochrome C Oxidase Polypeptide VIII; Cytochrome C Oxidase Polypeptide 8; Cytochrome C Oxidase Subunit VIII; cytochrome c oxidase subunit 8C, mitochondrial; COX VIII-3; cytochrome c oxidase polypeptide 8; cytochrome c oxidase polypeptide VIII; cytochrome c oxidase subunit 8-3; cytochrome c oxidase subunit VIII; cytochrome c oxidase subunit VIIIC |
Gene ID | 341947 |
mRNA Refseq | NM_182971 |
Protein Refseq | NP_892016 |
MIM | 616855 |
UniProt ID | Q7Z4L0 |
◆ Recombinant Proteins | ||
COX8C-2725H | Recombinant Human COX8C Protein, His (Fc)-Avi-tagged | +Inquiry |
Cox8c-2280M | Recombinant Mouse Cox8c Protein, Myc/DDK-tagged | +Inquiry |
COX8C-1766H | Recombinant Human COX8C Protein, GST-tagged | +Inquiry |
COX8C-542H | Recombinant Human COX8C Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
COX8C-1413H | Recombinant Human COX8C | +Inquiry |
◆ Cell & Tissue Lysates | ||
COX8C-7322HCL | Recombinant Human COX8C 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All COX8C Products
Required fields are marked with *
My Review for All COX8C Products
Required fields are marked with *