Recombinant Full Length Human CPN1 Protein, GST-tagged

• Cat.No.: CPN1-2097HF
• Product Overview: Human CPN1 full-length ORF ( NP_001299.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Tag: GST
• Protein Length: 458 amino acids
• Description: Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency. [provided by RefSeq, Jul 2008]
• Molecular Mass: 78.7 kDa
• AA Sequence: MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA
• Applications: Enzyme-linked Immunoabsorbent Assay
  Western Blot (Recombinant protein)
  Antibody Production
  Protein Array
• Notes: Best use within three months from the date of receipt of this protein.
• Storage: Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
• Storage Buffer: 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.

Gene Information

• Gene Name: CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ]
• Official Symbol: CPN1
• Synonyms: CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792
• Gene ID: 1369
• mRNA Refseq: NM_001308
• Protein Refseq: NP_001299
• MIM: 603103
• UniProt ID: P15169