Recombinant Human CPN1 Protein, GST-tagged
Cat.No. : | CPN1-1791H |
Product Overview : | Human CPN1 full-length ORF ( NP_001299.1, 1 a.a. - 458 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Wheat Germ |
Tag : | GST |
Description : | Carboxypeptidase N is a plasma metallo-protease that cleaves basic amino acids from the C terminal of peptides and proteins. The enzyme is important in the regulation of peptides like kinins and anaphylatoxins, and has also been known as kininase-1 and anaphylatoxin inactivator. This enzyme is a tetramer comprised of two identical regulatory subunits and two identical catalytic subunits; this gene encodes the catalytic subunit. Mutations in this gene can be associated with angioedema or chronic urticaria resulting from carboxypeptidase N deficiency. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 78.7 kDa |
AA Sequence : | MSDLLSVFLHLLLLFKLVAPVTFRHHRYDDLVRTLYKVQNECPGITRVYSIGRSVEGRHLYVLEFSDHPGIHEPLEPEVKYVGNMHGNEALGRELMLQLSEFLCEEFRNRNQRIVQLIQDTRIHILPSMNPDGYEVAAAQGPNKPGYLVGRNNANGVDLNRNFPDLNTYIYYNEKYGGPNHHLPLPDNWKSQVEPETRAVIRWMHSFNFVLSANLHGGAVVANYPYDKSFEHRVRGVRRTASTPTPDDKLFQKLAKVYSYAHGWMFQGWNCGDYFPDGITNGASWYSLSKGMQDFNYLHTNCFEITLELSCDKFPPEEELQREWLGNREALIQFLEQVHQGIKGMVLDENYNNLANAVISVSGINHDVTSGDHGDYFRLLLPGIYTVSATAPGYDPETVTVTVGPAEPTLVNFHLKRSIPQVSPVRRAPSRRHGVRAKVQPQARKKEMEMRQLQRGPA |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCI, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CPN1 carboxypeptidase N, polypeptide 1 [ Homo sapiens ] |
Official Symbol | CPN1 |
Synonyms | CPN1; carboxypeptidase N, polypeptide 1; carboxypeptidase N, polypeptide 1, 50kD; carboxypeptidase N catalytic chain; anaphylatoxin inactivator; arginine carboxypeptidase; carboxypeptidase K; kininase I; lysine carboxypeptidase; kininase-1; serum carboxypeptidase N; plasma carboxypeptidase B; carboxypeptidase N small subunit; carboxypeptidase N catalytic subunit; carboxypeptidase N polypeptide 1 50 kD; CPN; SCPN; FLJ40792; |
Gene ID | 1369 |
mRNA Refseq | NM_001308 |
Protein Refseq | NP_001299 |
MIM | 603103 |
UniProt ID | P15169 |
◆ Recombinant Proteins | ||
CPN1-1225R | Recombinant Rat CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPN1-1796H | Recombinant Human CPN1 Protein (Leu159-Leu325), N-His tagged | +Inquiry |
CPN1-1931M | Recombinant Mouse CPN1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CPN1-12039Z | Recombinant Zebrafish CPN1 | +Inquiry |
CPN1-3533H | Recombinant Human CPN1 protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CPN1-7310HCL | Recombinant Human CPN1 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CPN1 Products
Required fields are marked with *
My Review for All CPN1 Products
Required fields are marked with *