Recombinant Full Length Human CRB3 Protein, GST-tagged
Cat.No. : | CRB3-2259HF |
Product Overview : | Human CRB3 full-length ORF ( NP_631900.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 120 amino acids |
Description : | This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016] |
Molecular Mass : | 39.3 kDa |
AA Sequence : | MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRB3 crumbs homolog 3 (Drosophila) [ Homo sapiens ] |
Official Symbol | CRB3 |
Synonyms | CRB3; crumbs homolog 3 (Drosophila); crumbs protein homolog 3; MGC17303 |
Gene ID | 92359 |
mRNA Refseq | NM_139161 |
Protein Refseq | NP_631900 |
MIM | 609737 |
UniProt ID | Q9BUF7 |
◆ Recombinant Proteins | ||
CRB3-1836H | Recombinant Human CRB3 Protein, GST-tagged | +Inquiry |
CRB3-842R | Recombinant Rhesus Macaque CRB3 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRB3-2259HF | Recombinant Full Length Human CRB3 Protein, GST-tagged | +Inquiry |
CRB3-3882M | Recombinant Mouse CRB3 Protein | +Inquiry |
CRB3-11555H | Recombinant Human CRB3, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRB3-394HCL | Recombinant Human CRB3 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRB3 Products
Required fields are marked with *
My Review for All CRB3 Products
Required fields are marked with *