Recombinant Full Length Human CRB3 Protein, GST-tagged

Cat.No. : CRB3-2259HF
Product Overview : Human CRB3 full-length ORF ( NP_631900.1, 1 a.a. - 120 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 120 amino acids
Description : This gene encodes a member of the Crumbs family of proteins. This gene is widely expressed in epithelial tissues where the encoded protein isoforms play various roles such as the control of cytokinesis and ciliogenesis or the formation of tight junctions. Alternative splicing results in multiple transcript variants encoding different isoforms. [provided by RefSeq, Mar 2016]
Molecular Mass : 39.3 kDa
AA Sequence : MANPGLGLLLALGLPFLLARWGRAWGQIQTTSANENSTVLPSSTSSSSDGNLRPEAITAIIVVFSLLAALLLAVGLALLVRKLREKRQTEGTYRPSSEEQVGARVPPTPNLKLPPEERLI
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRB3 crumbs homolog 3 (Drosophila) [ Homo sapiens ]
Official Symbol CRB3
Synonyms CRB3; crumbs homolog 3 (Drosophila); crumbs protein homolog 3; MGC17303
Gene ID 92359
mRNA Refseq NM_139161
Protein Refseq NP_631900
MIM 609737
UniProt ID Q9BUF7

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRB3 Products

Required fields are marked with *

My Review for All CRB3 Products

Required fields are marked with *

0
cart-icon
0
compare icon