Recombinant Full Length Human CRELD2 Protein, C-Flag-tagged
Cat.No. : | CRELD2-709HFL |
Product Overview : | Recombinant Full Length Human CRELD2 Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | Mammalian Cells |
Tag : | Flag |
Description : | Predicted to enable calcium ion binding activity and protein disulfide isomerase activity. Predicted to be located in Golgi apparatus; endoplasmic reticulum; and extracellular space. |
Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
Molecular Mass : | 38 kDa |
AA Sequence : | MRLPRRAALGLLPLLLLLPPAPEAAKKPTPCHRCRGLVDKFNQGMVDTAKKNFGGGNTAWEEKTLSKYES SEIRLLEILEGLCESSDFECNQMLEAQEEHLEAWWLQLKSEYPDLFEWFCVKTLKVCCSPGTYGPDCLAC QGGSQRPCSGNGHCSGDGSRQGDGSCRCHMGYQGPLCTDCMDGYFSSLRNETHSICTACDESCKTCSGLT NRDCGECEVGWVLDEGACVDVDECAAEPPPCSAAQFCKNANGSYTCEECDSSCVGCTGEGPGNCKECISG YAREHGQCADVDECALAEKTCVRKNENCYNTPGSYVCVCPDGFEGTEDACVPPAEAEATEGESPTQLPSR EDLTRTRPLEQKLISEEDLAANDILDYKDDDDKV |
Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
Storage : | Store at -80 centigrade. |
Concentration : | >50 ug/mL as determined by microplate BCA method. |
Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
Protein Families : | Druggable Genome, Secreted Protein |
Full Length : | Full L. |
Gene Name | CRELD2 cysteine rich with EGF like domains 2 [ Homo sapiens (human) ] |
Official Symbol | CRELD2 |
Synonyms | DKFZp667O055; MGC11256 |
Gene ID | 79174 |
mRNA Refseq | NM_024324.5 |
Protein Refseq | NP_077300.3 |
MIM | 607171 |
UniProt ID | Q6UXH1 |
◆ Recombinant Proteins | ||
Creld2-986M | Active Recombinant Mouse Creld2 Protein, Fc-tagged | +Inquiry |
CRELD2-709HFL | Recombinant Full Length Human CRELD2 Protein, C-Flag-tagged | +Inquiry |
CRELD2-1595R | Recombinant Rat CRELD2 Protein | +Inquiry |
CRELD2-336H | Active Recombinant Human CRELD2, His-tagged | +Inquiry |
CRELD2-2295HF | Recombinant Full Length Human CRELD2 Protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRELD2-001MCL | Recombinant Mouse CRELD2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRELD2 Products
Required fields are marked with *
My Review for All CRELD2 Products
Required fields are marked with *
0
Inquiry Basket