Recombinant Full Length Human CREM Protein, GST-tagged

Cat.No. : CREM-2296HF
Product Overview : Human CREM full-length ORF ( NP_001872.3, 1 a.a. - 137 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 137 amino acids
Description : This gene encodes a bZIP transcription factor that binds to the cAMP responsive element found in many viral and cellular promoters. It is an important component of cAMP-mediated signal transduction during the spermatogenetic cycle, as well as other complex processes. Alternative promoter and translation initiation site usage allows this gene to exert spatial and temporal specificity to cAMP responsiveness. Multiple alternatively spliced transcript variants encoding several different isoforms have been found for this gene, with some of them functioning as activators and some as repressors of transcription. [provided by RefSeq, Jul 2008]
Molecular Mass : 41.3 kDa
AA Sequence : MTMETVESQHDGSITASLTESKSAHVQTQTGQNSIPALAQVAAIAETDESAESEGVIDSHKRREILSRRPSYRKILNELSSDVPGVPKIEEERSEEEGTPPSIATMAVPTSIYQTSTGQYSMYAAIRYDTVLALSLL
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CREM cAMP responsive element modulator [ Homo sapiens ]
Official Symbol CREM
Synonyms CREM; cAMP responsive element modulator; cAMP-responsive element modulator; hCREM 2; CREM 2beta-a protein; CREM 2alpha-b protein; cAMP response element modulator; inducible cAMP early repressor ICER; ICER; CREM-2; hCREM-2; MGC17881; MGC41893; MGC111110;
Gene ID 1390
mRNA Refseq NM_001881
Protein Refseq NP_001872
MIM 123812
UniProt ID Q03060

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CREM Products

Required fields are marked with *

My Review for All CREM Products

Required fields are marked with *

0
cart-icon