Recombinant Full Length Human CRIP1 Protein, GST-tagged

Cat.No. : CRIP1-2054HF
Product Overview : Human CRIP1 full-length ORF ( AAH02738, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 77 amino acids
Description : Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008]
Molecular Mass : 34.21 kDa
AA Sequence : MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ]
Official Symbol CRIP1
Synonyms CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971
Gene ID 1396
mRNA Refseq NM_001311
Protein Refseq NP_001302
MIM 123875
UniProt ID P50238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIP1 Products

Required fields are marked with *

My Review for All CRIP1 Products

Required fields are marked with *

0

Inquiry Basket

cartIcon