Recombinant Full Length Human CRIP1 Protein, GST-tagged
Cat.No. : | CRIP1-2054HF |
Product Overview : | Human CRIP1 full-length ORF ( AAH02738, 1 a.a. - 77 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 77 amino acids |
Description : | Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1; MIM 123876), rhombotin-1 (RBTN1; MIM 186921), rhombotin-2 (RBTN2; MIM 180385), and rhombotin-3 (RBTN3; MIM 180386). CRIP may be involved in intestinal zinc transport (Hempe and Cousins, 1991 [PubMed 1946385]).[supplied by OMIM, Mar 2008] |
Molecular Mass : | 34.21 kDa |
AA Sequence : | MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRIP1 cysteine-rich protein 1 (intestinal) [ Homo sapiens ] |
Official Symbol | CRIP1 |
Synonyms | CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971 |
Gene ID | 1396 |
mRNA Refseq | NM_001311 |
Protein Refseq | NP_001302 |
MIM | 123875 |
UniProt ID | P50238 |
◆ Recombinant Proteins | ||
Crip1-2311M | Recombinant Mouse Crip1 Protein, Myc/DDK-tagged | +Inquiry |
CRIP1-2732H | Recombinant Human CRIP1 Protein, His (Fc)-Avi-tagged | +Inquiry |
CRIP1-1029R | Recombinant Rhesus monkey CRIP1 Protein, His-tagged | +Inquiry |
CRIP1-7426Z | Recombinant Zebrafish CRIP1 | +Inquiry |
CRIP1-3905M | Recombinant Mouse CRIP1 Protein | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP1-200HCL | Recombinant Human CRIP1 lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIP1 Products
Required fields are marked with *
My Review for All CRIP1 Products
Required fields are marked with *