Recombinant Human CRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

Cat.No. : CRIP1-3776H
Product Overview : CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : HEK293
Tag : DDK&Myc
Description : Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1), rhombotin-1 (RBTN1), rhombotin-2 (RBTN2), and rhombotin-3 (RBTN3). CRIP may be involved in intestinal zinc transport.
Molecular Mass : 8.5 kDa
AA Sequence : MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
Purity : > 80% as determined by SDS-PAGE and Coomassie blue staining
Stability : Stable for 3 months from receipt of products under proper storage and handling conditions.
Storage : Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
Concentration : 50 μg/mL as determined by BCA
Storage Buffer : 100 mM glycine, 25 mM Tris-HCl, pH 7.3.
Gene Name CRIP1 cysteine rich protein 1 [ Homo sapiens (human) ]
Official Symbol CRIP1
Synonyms CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971;
Gene ID 1396
mRNA Refseq NM_001311
Protein Refseq NP_001302
MIM 123875
UniProt ID P50238

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRIP1 Products

Required fields are marked with *

My Review for All CRIP1 Products

Required fields are marked with *

0
cart-icon
0
compare icon