Recombinant Human CRIP1 Protein, Myc/DDK-tagged, C13 and N15-labeled

• Cat.No.: CRIP1-3776H
• Product Overview: CRIP1 MS Standard C13 and N15-labeled recombinant protein (NP_001302) with a C-terminal MYC/DDK tag, was expressed in HEK293 cells.

Specification

• Species: Human
• Source: HEK293
• Tag: DDK&Myc
• Description: Cysteine-rich intestinal protein (CRIP) belongs to the LIM/double zinc finger protein family, members of which include cysteine- and glycine-rich protein-1 (CSRP1), rhombotin-1 (RBTN1), rhombotin-2 (RBTN2), and rhombotin-3 (RBTN3). CRIP may be involved in intestinal zinc transport.
• Molecular Mass: 8.5 kDa
• AA Sequence: MPKCPKCNKEVYFAERVTSLGKDWHRPCLKCEKCGKTLTSGGHAEHEGKPYCNHPCYAAMFGPKGFGRGGAESHTFKTRTRPLEQKLISEEDLAANDILDYKDDDDKV
• Purity: > 80% as determined by SDS-PAGE and Coomassie blue staining
• Stability: Stable for 3 months from receipt of products under proper storage and handling conditions.
• Storage: Store at -80 centigrade. Avoid repeated freeze-thaw cycles.
• Concentration: 50 μg/mL as determined by BCA
• Storage Buffer: 100 mM glycine, 25 mM Tris-HCl, pH 7.3.

Gene Information

• Gene Name: CRIP1 cysteine rich protein 1 [ Homo sapiens (human) ]
• Official Symbol: CRIP1
• Synonyms: CRIP1; cysteine-rich protein 1 (intestinal); cysteine-rich protein 1; CRIP; cysteine-rich heart protein; cysteine-rich intestinal protein; CRHP; CRP1; CRP-1; FLJ40971
• Gene ID: 1396
• mRNA Refseq: NM_001311
• Protein Refseq: NP_001302
• MIM: 123875
• UniProt ID: P50238