Recombinant Full Length Human CRIP2 Protein, GST-tagged
| Cat.No. : | CRIP2-2056HF |
| Product Overview : | Human CRIP2 full-length ORF ( NP_001303, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | In Vitro Cell Free System |
| Tag : | GST |
| Protein Length : | 208 amino acids |
| Description : | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
| Molecular Mass : | 48.51 kDa |
| AA Sequence : | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
| Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
| Notes : | Best use within three months from the date of receipt of this protein. |
| Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
| Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
| Gene Name | CRIP2 cysteine-rich protein 2 [ Homo sapiens ] |
| Official Symbol | CRIP2 |
| Synonyms | CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP |
| Gene ID | 1397 |
| mRNA Refseq | NM_001312 |
| Protein Refseq | NP_001303 |
| MIM | 601183 |
| UniProt ID | P52943 |
| ◆ Recombinant Proteins | ||
| CRIP2-1600R | Recombinant Rat CRIP2 Protein | +Inquiry |
| CRIP2-1257R | Recombinant Rat CRIP2 Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRIP2-491H | Recombinant Human CRIP2, None tagged | +Inquiry |
| Crip2-2312M | Recombinant Mouse Crip2 Protein, Myc/DDK-tagged | +Inquiry |
| CRIP2-2056HF | Recombinant Full Length Human CRIP2 Protein, GST-tagged | +Inquiry |
| ◆ Cell & Tissue Lysates | ||
| CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
| CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIP2 Products
Required fields are marked with *
My Review for All CRIP2 Products
Required fields are marked with *



