Recombinant Full Length Human CRIP2 Protein, GST-tagged
Cat.No. : | CRIP2-2056HF |
Product Overview : | Human CRIP2 full-length ORF ( NP_001303, 1 a.a. - 208 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 208 amino acids |
Description : | This gene encodes a putative transcription factor with two LIM zinc-binding domains. The encoded protein may participate in the differentiation of smooth muscle tissue. Alternative splicing results in multiple transcript variants. [provided by RefSeq, Aug 2012] |
Molecular Mass : | 48.51 kDa |
AA Sequence : | MASKCPKCDKTVYFAEKVSSLGKDWHKFCLKCERCSKTLTPGGHAEHDGKPFCHKPCYATLFGPKGVNIGGAGSYIYEKPLAEGPQVTGPIEVPAARAEERKASGPPKGPSRASSVTTFTGEPNTCPRCSKKVYFAEKVTSLGKDWHRPCLRCERCGKTLTPGGHAEHDGQPYCHKPCYGILFGPKGVNTGAVGSYIYDRDPEGKVQP |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRIP2 cysteine-rich protein 2 [ Homo sapiens ] |
Official Symbol | CRIP2 |
Synonyms | CRIP2; cysteine-rich protein 2; CRP2; ESP1; CRP-2; Cystein-rich intestinal protein; CRIP |
Gene ID | 1397 |
mRNA Refseq | NM_001312 |
Protein Refseq | NP_001303 |
MIM | 601183 |
UniProt ID | P52943 |
◆ Recombinant Proteins | ||
CRIP2-1238H | Recombinant Human CRIP2 protein, GST-tagged | +Inquiry |
CRIP2-3051H | Recombinant Human Cysteine-rich Protein 2, His-tagged | +Inquiry |
CRIP2-3325H | Recombinant Human CRIP2 Protein, MYC/DDK-tagged | +Inquiry |
CRIP2-12660Z | Recombinant Zebrafish CRIP2 | +Inquiry |
CRIP2-2769H | Recombinant Human CRIP2 Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRIP2-001HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
CRIP2-002HCL | Recombinant Human CRIP2 cell lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRIP2 Products
Required fields are marked with *
My Review for All CRIP2 Products
Required fields are marked with *