Recombinant Full Length Human CRLF2 Protein, GST-tagged

Cat.No. : CRLF2-2069HF
Product Overview : Human CRLF2 full-length ORF (BAB15557.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal.
  • Specification
  • Gene Information
  • Related Products
  • Download
Species : Human
Source : In Vitro Cell Free System
Tag : GST
Protein Length : 232 amino acids
Description : This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014]
Molecular Mass : 53.1 kDa
AA Sequence : MGRLVLLWGAAVFLLGGWMALGQGGAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQTQSRSVTQAGVQWCDLCLLQPSPPRFKRFSCLSLPSSWDYRHPPPRLANFCIISRDGVSPCWPGWSRTCDLR
Applications : Enzyme-linked Immunoabsorbent Assay
Western Blot (Recombinant protein)
Antibody Production
Protein Array
Notes : Best use within three months from the date of receipt of this protein.
Storage : Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing.
Storage Buffer : 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer.
Gene Name CRLF2 cytokine receptor-like factor 2 [ Homo sapiens ]
Official Symbol CRLF2
Synonyms CRLF2; cytokine receptor-like factor 2; CRL2; TSLPR; IL-XR; TSLP receptor; P2RY8/CRLF2 fusion; cytokine receptor-like 2; cytokine receptor CRL2 precusor; thymic stromal lymphopoietin receptor; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin receptor; CRLF2Y
Gene ID 64109
mRNA Refseq NM_001012288
Protein Refseq NP_001012288
MIM 300357
UniProt ID Q9HC73

Not For Human Consumption!

Inquiry

  • Reviews (0)
  • Q&As (0)

Customer Reviews

Write a review

Ask a Question for All CRLF2 Products

Required fields are marked with *

My Review for All CRLF2 Products

Required fields are marked with *

0
cart-icon