Recombinant Full Length Human CRLF2 Protein, GST-tagged
Cat.No. : | CRLF2-2069HF |
Product Overview : | Human CRLF2 full-length ORF (BAB15557.1, 1 a.a. - 232 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 232 amino acids |
Description : | This gene encodes a member of the type I cytokine receptor family. The encoded protein is a receptor for thymic stromal lymphopoietin (TSLP). Together with the interleukin 7 receptor (IL7R), the encoded protein and TSLP activate STAT3, STAT5, and JAK2 pathways, which control processes such as cell proliferation and development of the hematopoietic system. Rearrangement of this gene with immunoglobulin heavy chain gene (IGH) on chromosome 14, or with P2Y purinoceptor 8 gene (P2RY8) on the same X or Y chromosomes is associated with B-progenitor acute lymphoblastic leukemia (ALL) and Down syndrome ALL. Alternatively spliced transcript variants have been found for this gene. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 53.1 kDa |
AA Sequence : | MGRLVLLWGAAVFLLGGWMALGQGGAEGVQIQIIYFNLETVQVTWNASKYSRTNLTFHYRFNGDEAYDQCTNYLLQEGHTSGCLLDAEQRDDILYFSIRNGTHPVFTASRWMVYYLKPSSPKHVRFSWHQDAVTVTCSDLSYGDLLYEVQYRSPFDTEWQTQSRSVTQAGVQWCDLCLLQPSPPRFKRFSCLSLPSSWDYRHPPPRLANFCIISRDGVSPCWPGWSRTCDLR |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRLF2 cytokine receptor-like factor 2 [ Homo sapiens ] |
Official Symbol | CRLF2 |
Synonyms | CRLF2; cytokine receptor-like factor 2; CRL2; TSLPR; IL-XR; TSLP receptor; P2RY8/CRLF2 fusion; cytokine receptor-like 2; cytokine receptor CRL2 precusor; thymic stromal lymphopoietin receptor; thymic stromal lymphopoietin protein receptor; thymic stromal-derived lymphopoietin receptor; CRLF2Y |
Gene ID | 64109 |
mRNA Refseq | NM_001012288 |
Protein Refseq | NP_001012288 |
MIM | 300357 |
UniProt ID | Q9HC73 |
◆ Recombinant Proteins | ||
Crlf2-129M | Recombinant Mouse Crlf2 Protein, His (Fc)-Avi-tagged | +Inquiry |
Crlf2-6614M | Recombinant Mouse Crlf2 Protein, Myc/DDK-tagged | +Inquiry |
CRLF2-75H | Recombinant Human CRLF2, MYC/DDK-tagged | +Inquiry |
CRLF2-7578H | Recombinant Human CRLF2, His-tagged | +Inquiry |
CRLF2-46H | Recombinant Human CRLF2 Protein, His (Fc)-Avi-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRLF2-7275HCL | Recombinant Human CRLF2 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRLF2 Products
Required fields are marked with *
My Review for All CRLF2 Products
Required fields are marked with *