Recombinant Full Length Human CRPPA Protein, C-Flag-tagged
| Cat.No. : | CRPPA-1579HFL |
| Product Overview : | Recombinant Full Length Human CRPPA Protein, fused to Flag-tag at C-terminus, was expressed in Mammalian cells. |
- Specification
- Gene Information
- Related Products
- Download
| Species : | Human |
| Source : | Mammalian Cells |
| Tag : | Flag |
| Description : | This gene encodes a 2-C-methyl-D-erythritol 4-phosphate cytidylyltransferase-like protein. Mutations in this gene are the cause of Walker-Warburg syndrome. Alternate splicing results in multiple transcript variants. |
| Form : | 25 mM Tris HCl, pH 7.3, 100 mM glycine, 10% glycerol. |
| Molecular Mass : | 49.7 kDa |
| AA Sequence : | MEAGPPGSARPAEPGPCLSGQRGADHTASASLQSVAGTEPGRHPQAVAAVLPAGGCGERMGVPTPKQFCP ILERPLISYTLQALERVCWIKDIVVAVTGENMEVMKSIIQKYQHKRISLVEAGVTRHRSIFNGLKALAED QINSKLSKPEVVIIHDAVRPFVEEGVLLKVVTAAKEHGAAGAIRPLVSTVVSPSADGCLDYSLERARHRA SEMPQAFLFDVIYEAYQQCSDYDLEFGTECLQLALKYCCTKAKLVEGSPDLWKVTYKRDLYAAESIIKER ISQEICVVMDTEEDNKHVGHLLEEVLKSELNHVKVTSEALGHAGRHLQQIILDQCYNFVCVNVTTSDFQE TQKLLSMLEESSLCILYPVVVVSVHFLDFKLVPPSQKMENLMQIREFAKEVKERNILLYGLLISYPQDDQ KLQESLRQGAIIIASLIKERNSGLIGQLLIATRTRPLEQKLISEEDLAANDILDYKDDDDKV |
| Purity : | > 80% as determined by SDS-PAGE and Coomassie blue staining. |
| Stability : | Stable for 12 months from the date of receipt of the product under proper storage and handling conditions. Avoid repeated freeze-thaw cycles. |
| Storage : | Store at -80 centigrade. |
| Concentration : | >50 ug/mL as determined by microplate BCA method. |
| Preparation : | Recombinant protein was captured through anti-DDK affinity column followed by conventional chromatography steps. |
| Full Length : | Full L. |
| Gene Name | CRPPA CDP-L-ribitol pyrophosphorylase A [ Homo sapiens (human) ] |
| Official Symbol | CRPPA |
| Synonyms | Nip; ISPD; hISPD; MDDGA7; MDDGC7; LGMDR20 |
| Gene ID | 729920 |
| mRNA Refseq | NM_001101426.4 |
| Protein Refseq | NP_001094896.1 |
| MIM | 614631 |
| UniProt ID | A4D126 |
| ◆ Recombinant Proteins | ||
| CRPPA-665H | Recombinant Human CRPPA Protein, His (Fc)-Avi-tagged | +Inquiry |
| CRPPA-1579HFL | Recombinant Full Length Human CRPPA Protein, C-Flag-tagged | +Inquiry |
| CRPPA-6024H | Recombinant Human CRPPA Protein, Myc/DDK-tagged, C13 and N15-labeled | +Inquiry |
| Crppa-1425M | Recombinant Mouse Crppa Protein, Myc/DDK-tagged | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRPPA Products
Required fields are marked with *
My Review for All CRPPA Products
Required fields are marked with *
