Recombinant Full Length Human CRYGS Protein, GST-tagged
Cat.No. : | CRYGS-2142HF |
Product Overview : | Human CRYGS full-length ORF ( NP_060011.1, 1 a.a. - 178 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 178 amino acids |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. This gene encodes a protein initially considered to be a beta-crystallin but the encoded protein is monomeric and has greater sequence similarity to other gamma-crystallins. This gene encodes the most significant gamma-crystallin in adult eye lens tissue. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. [provided by RefSeq, Jul 2008] |
Molecular Mass : | 47.4 kDa |
AA Sequence : | MSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRYGS crystallin, gamma S [ Homo sapiens ] |
Official Symbol | CRYGS |
Synonyms | CRYGS; crystallin, gamma S; CRYG8; beta-crystallin S; crystallin; gamma 8; gamma-S-crystallin; gamma-crystallin S; crystallin, gamma 8 |
Gene ID | 1427 |
mRNA Refseq | NM_017541 |
Protein Refseq | NP_060011 |
MIM | 123730 |
UniProt ID | P22914 |
◆ Recombinant Proteins | ||
CRYGS-1279R | Recombinant Rat CRYGS Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYGS-3632H | Recombinant Human CRYGS, His-tagged | +Inquiry |
CRYGS-11607H | Recombinant Human CRYGS protein, His-tagged | +Inquiry |
CRYGS-2142HF | Recombinant Full Length Human CRYGS Protein, GST-tagged | +Inquiry |
CRYGS-1608H | Recombinant Human CRYGS protein, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGS-7255HCL | Recombinant Human CRYGS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGS Products
Required fields are marked with *
My Review for All CRYGS Products
Required fields are marked with *