Recombinant Human CRYGS, His-tagged
Cat.No. : | CRYGS-27478TH |
Product Overview : | Recombinant full length Human Beta crystallin S with an N terminal His tag; 202 amino acids with the tag; predicted MWt: 23.6 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | E.coli |
Tag : | His |
Protein Length : | 178 amino acids |
Description : | Crystallins are separated into two classes: taxon-specific, or enzyme, and ubiquitous. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. Since lens central fiber cells lose their nuclei during development, these crystallins are made and then retained throughout life, making them extremely stable proteins. Mammalian lens crystallins are divided into alpha, beta, and gamma families; beta and gamma crystallins are also considered as a superfamily. Alpha and beta families are further divided into acidic and basic groups. Seven protein regions exist in crystallins: four homologous motifs, a connecting peptide, and N- and C-terminal extensions. Gamma-crystallins are a homogeneous group of highly symmetrical, monomeric proteins typically lacking connecting peptides and terminal extensions. They are differentially regulated after early development. This gene encodes a protein initially considered to be a beta-crystallin but the encoded protein is monomeric and has greater sequence similarity to other gamma-crystallins. This gene encodes the most significant gamma-crystallin in adult eye lens tissue. Whether due to aging or mutations in specific genes, gamma-crystallins have been involved in cataract formation. |
Conjugation : | HIS |
Molecular Weight : | 23.600kDa inclusive of tags |
Form : | Liquid |
Purity : | >95% by SDS-PAGE |
Storage buffer : | pH: 8.00Constituents:10% Glycerol, 0.02% DTT, 0.58% Sodium chlorideNote: Contains 89% Tris-HCl buffer. |
Storage : | Store at +4°C short term (1-2 weeks). Aliquot and store at -20°C or -80°C. Avoid repeated freeze / thaw cycles. |
Sequences of amino acids : | MGSSHHHHHHSSGLVPRGSHMGSHMSKTGTKITFYEDKNFQGRRYDCDCDCADFHTYLSRCNSIKVEGGTWAVYERPNFAGYMYILPQGEYPEYQRWMGLNDRLSSCRAVHLPSGGQYKIQIFEKGDFSGQMYETTEDCPSIMEQFHMREIHSCKVLEGVWIFYELPNYRGRQYLLDKKEYRKPIDWGAASPAVQSFRRIVE |
Sequence Similarities : | Belongs to the beta/gamma-crystallin family.Contains 4 beta/gamma crystallin Greek key domains. |
Gene Name | CRYGS crystallin, gamma S [ Homo sapiens ] |
Official Symbol | CRYGS |
Synonyms | CRYGS; crystallin, gamma S; CRYG8; beta-crystallin S; crystallin; gamma 8; |
Gene ID | 1427 |
mRNA Refseq | NM_017541 |
Protein Refseq | NP_060011 |
Uniprot ID | P22914 |
Chromosome Location | 3 |
Function | structural constituent of eye lens; |
◆ Recombinant Proteins | ||
CRYGS-2737H | Recombinant Human CRYGS protein, GST-tagged | +Inquiry |
CRYGS-2142HF | Recombinant Full Length Human CRYGS Protein, GST-tagged | +Inquiry |
CRYGS-1621R | Recombinant Rat CRYGS Protein | +Inquiry |
CRYGS-4047C | Recombinant Chicken CRYGS | +Inquiry |
CRYGS-3632H | Recombinant Human CRYGS, His-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYGS-7255HCL | Recombinant Human CRYGS 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews (0)
- Q&As (0)
Ask a Question for All CRYGS Products
Required fields are marked with *
My Review for All CRYGS Products
Required fields are marked with *
0
Inquiry Basket