Recombinant Full Length Human CRYM Protein, GST-tagged
Cat.No. : | CRYM-2144HF |
Product Overview : | Human CRYM full-length ORF ( AAH18061, 1 a.a. - 314 a.a.) recombinant protein with GST-tag at N-terminal. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Tag : | GST |
Protein Length : | 314 amino acids |
Description : | Crystallins are separated into two classes: taxon-specific and ubiquitous. The former class is also called phylogenetically-restricted crystallins. The latter class constitutes the major proteins of vertebrate eye lens and maintains the transparency and refractive index of the lens. This gene encodes a taxon-specific crystallin protein that binds NADPH and has sequence similarity to bacterial ornithine cyclodeaminases. The encoded protein does not perform a structural role in lens tissue, and instead it binds thyroid hormone for possible regulatory or developmental roles. Mutations in this gene have been associated with autosomal dominant non-syndromic deafness. [provided by RefSeq, Sep 2014] |
Molecular Mass : | 60.28 kDa |
AA Sequence : | MSRVPAFLSAAEVEEHLRSSSLLIPPLETALANFSSGPEGGVMQPVRTVVPVTKHRGYLGVMPAYSAAEDALTTKLVTFYEDRGITSVVPSHQATVLLFEPSNGTLLAVMDGNVITAKRTAAVSAIATKFLKPPSSEVLCILGAGVQAYSHYEIFTEQFSFKEVRIWNRTKENAEKFADTVQGEVRVCSSVQEAVAGADVIITVTLATEPILFGEWVKPGAHINAVGASRPDWRELDDELMKEAVLYVDSQEAALKESGDVLLSGAEIFAELGEVIKGVKPAHCEKTTVFKSLGMAVEDTVAAKLIYDSWSSGK |
Applications : | Enzyme-linked Immunoabsorbent Assay Western Blot (Recombinant protein) Antibody Production Protein Array |
Notes : | Best use within three months from the date of receipt of this protein. |
Storage : | Store at -80 centigrade. Aliquot to avoid repeated freezing and thawing. |
Storage Buffer : | 50 mM Tris-HCl, 10 mM reduced Glutathione, pH=8.0 in the elution buffer. |
Gene Name | CRYM crystallin, mu [ Homo sapiens ] |
Official Symbol | CRYM |
Synonyms | CRYM; crystallin, mu; thiomorpholine-carboxylate dehydrogenase; DFNA40; ketimine reductase; mu-crystallin homolog; NADP-regulated thyroid-hormone binding protein; THBP |
Gene ID | 1428 |
mRNA Refseq | NM_001014444 |
Protein Refseq | NP_001014444 |
MIM | 123740 |
UniProt ID | Q14894 |
◆ Recombinant Proteins | ||
CRYM-5158Z | Recombinant Zebrafish CRYM | +Inquiry |
Crym-2335M | Recombinant Mouse Crym Protein, Myc/DDK-tagged | +Inquiry |
CRYM-1281R | Recombinant Rat CRYM Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYM-872R | Recombinant Rhesus Macaque CRYM Protein, His (Fc)-Avi-tagged | +Inquiry |
CRYM-11608H | Recombinant Human CRYM, GST-tagged | +Inquiry |
◆ Cell & Tissue Lysates | ||
CRYM-7254HCL | Recombinant Human CRYM 293 Cell Lysate | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CRYM Products
Required fields are marked with *
My Review for All CRYM Products
Required fields are marked with *
0
Inquiry Basket