Recombinant Full Length Human CSE1L Protein
Cat.No. : | CSE1L-95HF |
Product Overview : | Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa. |
- Specification
- Gene Information
- Related Products
- Download
Species : | Human |
Source : | In Vitro Cell Free System |
Protein Length : | 195 amino acids |
Description : | Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation. |
Form : | Liquid |
Molecular Mass : | 47.520kDa inclusive of tags |
AA Sequence : | MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW |
Purity : | Proprietary Purification |
Storage : | Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles. |
Storage Buffer : | pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione. |
Gene Name | CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ] |
Official Symbol | CSE1L |
Synonyms | CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2 |
Gene ID | 1434 |
mRNA Refseq | NM_001316 |
Protein Refseq | NP_001307 |
MIM | 601342 |
UniProt ID | P55060 |
◆ Recombinant Proteins | ||
CSE1L-95HF | Recombinant Full Length Human CSE1L Protein | +Inquiry |
CSE1L-2732H | Recombinant Human CSE1L Protein (1-200 aa), His-SUMO-tagged | +Inquiry |
CSE1L-9523HCL | Recombinant Human CSE1L Over-expression Cell Lysate | +Inquiry |
CSE1L-27394TH | Recombinant Human CSE1L | +Inquiry |
CSE1L-27953TH | Recombinant Human CSE1L | +Inquiry |
Not For Human Consumption!
Inquiry
- Reviews
- Q&As
Ask a Question for All CSE1L Products
Required fields are marked with *
My Review for All CSE1L Products
Required fields are marked with *
0
Inquiry Basket