Recombinant Full Length Human CSE1L Protein

• Cat.No.: CSE1L-95HF
• Product Overview: Recombinant full length Human Cellular Apoptosis Susceptibility with N terminal proprietary tag, predicted mwt: 47.52 kDa.

Specification

• Species: Human
• Source: In Vitro Cell Free System
• Protein Length: 195 amino acids
• Description: Proteins that carry a nuclear localization signal (NLS) are transported into the nucleus by the importin-alpha/beta heterodimer. Importin-alpha binds the NLS, while importin-beta mediates translocation through the nuclear pore complex. After translocation, RanGTP binds importin-beta and displaces importin-alpha. Importin-alpha must then be returned to the cytoplasm, leaving the NLS protein behind. The protein encoded by this gene binds strongly to NLS-free importin-alpha, and this binding is released in the cytoplasm by the combined action of RANBP1 and RANGAP1. In addition, the encoded protein may play a role both in apoptosis and in cell proliferation.
• Form: Liquid
• Molecular Mass: 47.520kDa inclusive of tags
• AA Sequence: MELSDANLQTLTEYLKKTLDPDPAIRRPAEKFLESVEGNQ NYPLLLLTLLEKSQDNVIKVCASVTFKNYIKRNWRIVEDE PNKICEADRVAIKANIVHLMLSSPEQIQKQLSDAISIIGR EDFPQKWPDLLTEMVNRFQSGDFHVINGVLRTAHSLFKRY RHEFKSNELWTEIKLVLDAFALPLTNLFKVWNASW
• Purity: Proprietary Purification
• Storage: Shipped on dry ice. Upon delivery aliquot and store at -80 centigrade. Avoid freeze / thaw cycles.
• Storage Buffer: pH: 8.00. Constituents:0.79% Tris HCl, 0.31% Glutathione.

Gene Information

• Gene Name: CSE1L CSE1 chromosome segregation 1-like (yeast) [ Homo sapiens ]
• Official Symbol: CSE1L
• Synonyms: CSE1L; CSE1 chromosome segregation 1-like (yeast); chromosome segregation 1 (yeast homolog) like; exportin-2; CAS; CSE1; XPO2
• Gene ID: 1434
• mRNA Refseq: NM_001316
• Protein Refseq: NP_001307
• MIM: 601342
• UniProt ID: P55060